KEGG   Polaromonas naphthalenivorans: Pnap_0401Help
Entry
Pnap_0401         CDS       T00459                                 

Definition
(GenBank) putative transcriptional regulator, GntR family
  KO
K05825  2-aminoadipate transaminase [EC:2.6.1.-]
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna00300  Lysine biosynthesis
pna01100  Metabolic pathways
pna01130  Biosynthesis of antibiotics
pna01210  2-Oxocarboxylic acid metabolism
Brite
KEGG Orthology (KO) [BR:pna00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Pnap_0401
Enzymes [BR:pna01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-  
     Pnap_0401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_MocR ATP-grasp_2
Motif
Other DBs
NCBI-ProteinID: ABM35724
UniProt: A1VJ96
Position
complement(399420..400640)
Genome map
AA seq 406 aa AA seqDB search
MKWTQARRAQKMNPSVIREILKVTEKPGIISFAGGLPSPKTFPVSAFSAACEKVLREDGH
AALQYAASEGYAPLREMVASMLPWNVDPALVLITTGSQQGLDLIAKVLIDEGSRVLVETP
TYLGALQAFTPMEPEIVSVASDDGGVDIADLAAKAEGARFFYVLPNFQNPTGRTMPEERR
AALSAEAARLGLPLVEDNPYGDLWFDTPPPLPLTARNPEGCVYLGSFSKVLAPGLRLGFM
VAPASIFPKLLQAKQAADLHSPGFNQRLVAEVMKDGFLDRHVPTIRALYKSQRDAMLAAM
VREMPEGVEWNTPAGGMFLWVRLPEGMNAIELLPRAVERNVAFVPGWAFYADQPDARTLR
LSFVTSSVAQIDIGIAALAGAIREMRAGSSASVAGAAPQLEAQPQT
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggacccaggcgcgacgtgcgcaaaaaatgaacccctcggtgatccgcgagatc
ctgaaggtcactgaaaagcccggcatcatcagctttgccggcggcctgccctcgcccaag
acctttccggtcagcgccttcagcgcggcctgcgaaaaggtgctgcgcgaagacggccat
gcggcgctgcagtacgcggccagcgaaggctatgcgcccctgcgcgagatggtagccagc
atgctgccgtggaatgtggacccggcattggtcctgatcaccaccggctcgcagcagggg
ctggacctgatcgccaaggtgctgatcgacgagggcagccgcgtgctggtcgagacgccg
acttacctcggcgcgctgcaggccttcacgcccatggagcccgagatcgtcagcgtggcc
agcgacgacggcggcgtggacattgccgatctggccgccaaggcagaaggcgcacgcttt
ttctacgtgctgcccaatttccagaacccgaccggccgcaccatgcccgaggagcgccgc
gccgcgctcagcgccgaggccgcgcgcctgggcctgccgctggtcgaggacaacccctac
ggcgacctgtggttcgacacgccgccgccgctgccgctgaccgcgcgcaatcccgagggc
tgcgtctatctgggatcgttttccaaagtgctcgcgcccggactgcggctgggcttcatg
gtggcgcccgcctccatcttccccaagctgctgcaggccaagcaggccgccgacctgcac
agccccggcttcaaccagcggctggtggccgaggtgatgaaggacggcttcctggaccgc
catgtgccgaccatccgcgccctgtacaaatcccagcgcgacgccatgctggccgccatg
gtgcgcgagatgcccgaaggcgttgaatggaacaccccggccggcggcatgttcctgtgg
gtgcgcctgcccgagggcatgaatgcgattgaactgctgcccagggcggtcgagcgcaat
gtggcctttgttccgggctgggcgttttatgccgaccagcccgacgcgcgcacgctgcgc
ctgtccttcgtgacttccagcgtggcgcagatcgacatcggcattgccgcgctggccggc
gccattcgcgagatgcgcgccggatcaagcgcttcggttgcaggcgccgccccgcaactt
gaagcgcagccccagacctga

DBGET integrated database retrieval system