KEGG   Polaromonas naphthalenivorans: Pnap_0410Help
Entry
Pnap_0410         CDS       T00459                                 

Definition
(GenBank) putative transposase of insertion sequence ISRm10-1
Organism
pna  Polaromonas naphthalenivorans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(419901..420377)
Genome map
AA seq 158 aa AA seqDB search
MAPTRGRSPRGQRCRGFAPAGHWRTTTFVCALSTQGLRAPLVLDGPLNGPAFRAWVEQFL
VPELRPSDIVVMDNLSAHKVAGIQAAIEQAGATVKYLPPYSPDFNPIEQVFAKLKAMLRK
TQARTVDALWSAIGQLLDRFGSAECERYVRHCGYCGSG
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggccccgacgcggggccgctcgccgcggggccagcgctgccggggctttgcgcccgcc
ggccactggcgcaccaccacgtttgtctgcgcgctgagcacccaggggcttcgggcgccc
ctggtacttgacggccccctcaacgggcctgcctttcgcgcctgggtcgagcagtttctc
gtgcccgaactgcggcccagcgacatcgtggtaatggacaacctcagcgcccataaagtc
gccggcatccaggcggccatcgagcaagccggggcgacggtgaagtacctgccgccctac
agcccggacttcaaccccatcgagcaggtctttgccaagctcaaggcgatgctgcgaaag
acccaggccagaaccgtcgatgccttgtggagcgccattggccaattgctcgaccggttt
ggcagcgccgagtgcgagcgctacgttcgccactgtggctattgcgggtcagggtga

DBGET integrated database retrieval system