KEGG   Polaromonas naphthalenivorans: Pnap_0415Help
Entry
Pnap_0415         CDS       T00459                                 

Definition
(GenBank) Recombinase
Organism
pna  Polaromonas naphthalenivorans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
431574..433643
Genome map
AA seq 689 aa AA seqDB search
MTTSDLLPAAVLRRKAVVYVRQSTQSQVQTNLESQRRQYDLVAQARRLGFAQVEVIDDDL
GRSASGMVDRPGFERLVAWLCAGEVGAVLCFDASRLARNGRDWHHLLELCGLVEARVIDP
DGVYDPCRPNDRLLLGMKGSISEFELGVIRARMFEAARAKAHRGELRISVPIGYVWHRQI
GLGLDPDMRLQETIRLIFARFRTLGSARQVMLSLAADDVHFPRPSDGKKMVSFDWTPIRY
RNVISILKNPFYAGVYAYGKSEKRTTLVQGRLRKTYKHGKPLDRWDVMIKDHHEAYIDWA
EFERNQKQLAVNAYGKVDGTKSGRGGRALLAGMLCCGRCGRRLTVAYTGRGVPQPVYRCD
RPNLQLAQPRCFTFGARRPDEAIARELLRAVEPLAVEAALQAERRYMQVQADQRRIVELE
LQQARYEAGLAERRYAACDPDHRLIAAQLEKSWEAALQRVLACEQRLNVARQVQSSARPD
LTGLEEDLAAAWDAPGVTMRARQQLLRTLVKDIVADVDDQAREVVLTIHWRGGQHSQVRV
VKPRTGEHGCRTPDEALAVMRSMAGKWSDEHIAATLNRMGLPTGQAKTWTAHRVSSVRRV
NDIHAYRSAEKDGQWLTMSEAAAKLGVNNHRIRRLIKEGLLPAEQVVPRAPYQIRASDLL
EQRVIDAIARTLSPCRAVSEKQMSMFSST
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgacgacctctgatctgttgccggccgcagtgctgcgtcgcaaagctgtcgtctatgtg
cgccagtcaactcagtcacaagtgcagaccaacctggagagccagcgccggcagtacgac
ctggtggcgcaagctcgccgcctcggatttgcgcaggtggaagtcatcgacgatgacctc
ggccgttccgccagcggtatggtggaccgaccgggctttgagcggctcgtggcctggttg
tgcgctggcgaagtcggcgccgtcttgtgcttcgacgcctcccggcttgcccgcaatgga
cgtgactggcaccacctgctggagctgtgtggcctggtcgaggcacgggtcattgacccg
gacggcgtgtacgacccgtgccggcccaacgaccgtctgctgctgggcatgaagggcagt
atcagcgagttcgagctcggcgtgatcagggcaaggatgttcgaagcggctcgtgccaag
gcgcatcgcggtgaattgcgcatcagtgtccccatcggctacgtctggcaccggcagatc
gggttggggttggatccggacatgcgcctgcaggagacgatccggttgatcttcgcgcgc
tttcgcacgctcggcagcgccaggcaggtgatgctttcccttgcggcagacgatgtccat
ttcccacggccctcggacggcaagaagatggtgagctttgactggacgccgatccgctac
cgcaacgtgatctcgatactcaagaatcccttctatgccggcgtctatgcatacggcaag
agtgagaagcgtacgacgctcgtgcaagggcgacttcgcaagacctacaagcatggcaag
ccgctcgatcggtgggacgtgatgatcaaggatcatcacgaagcctacatcgactgggcc
gagttcgaacgtaatcaaaagcagcttgccgtcaatgcctacggtaaagtcgatggaacg
aagtccgggcgcggtggccgggcgttgctcgcgggaatgctgtgctgcgggcgttgtggg
cggcgcctgacggtggcgtatacggggcgcggggtgcctcaaccggtgtaccgatgtgac
cgccccaatcttcagctcgctcagccgagatgcttcacgtttggcgcacgccgacccgac
gaagcgattgcccgggagctgctgcgcgctgtggagcccttggccgtcgaggcggcattg
caggctgagcggaggtatatgcaagttcaagcggaccagcgacgaatcgtggagctggag
ttgcagcaggcccgttacgaggctggtttggcagagcgccgctacgcggcctgtgaccca
gaccatcgcttgattgccgcacaactggagaagagctgggaggctgctttgcagcgcgtg
ctcgcctgtgagcagcgcttgaacgtggcccggcaggtgcagtcctctgccaggcccgac
ttgaccggcttggaggaagatctcgcggccgcgtgggatgcgccgggcgtgaccatgcgc
gcgcgccagcagttgctgcgcacactcgtcaaggacatcgttgccgatgtcgacgaccag
gcccgcgaggtcgtgctgacgattcactggcgcggaggccagcattcgcaggtgagggtc
gtcaagccacgcacaggcgagcacggctgccgcacgcccgatgaagccctggccgtcatg
cgcagcatggcaggcaagtggtctgacgagcacatcgccgcgacgctcaatcgcatggga
ctgcccacgggccaggccaagacgtggaccgcgcatcgcgtgagctccgtgcgcagggtc
aacgacatccatgcgtaccgctcggccgagaaggacgggcagtggttgaccatgtcagaa
gcggctgccaagctcggggtcaacaaccaccgcattcggcgcctgatcaaggagggattg
ctgccggccgaacaggtggtgccgcgggcgccgtatcagattcgggccagcgacctgctc
gagcagcgggtgattgacgccatcgcgcgaacactcagcccgtgtcgggccgtcagcgag
aagcagatgtcaatgttttcaagcacttaa

DBGET integrated database retrieval system