KEGG   Polaromonas naphthalenivorans: Pnap_0416Help
Entry
Pnap_0416         CDS       T00459                                 

Definition
(GenBank) transposase IS66
Organism
pna  Polaromonas naphthalenivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DDE_Tnp_IS66
Motif
Other DBs
NCBI-ProteinID: ABM35739
UniProt: A1VJB1
Position
complement(433656..434240)
Genome map
AA seq 194 aa AA seqDB search
MGWLKPGNGKTHRAYLWAYAPGAFEDLKAVVHDFCESRAGAHARGFLGAWQGTLVCDDYV
AYKQLFTQGIMESGCMAHARRHLFELHVNHQSQIAAQALHYIAQLYEIEREVKTLRADER
QRIRQARSKPLADALHQWMVLERSQILDGSATAKALDYSLRRWGALMRFLDDGQLPIDNN
WVENQIRPVAMACS
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgggatggctcaaacccggcaatggcaaaacgcaccgggcttatctctgggcctacgcg
ccgggcgcctttgaagatttgaaggccgtggtccatgacttttgcgagagccgcgcgggc
gcgcatgccagaggctttctgggtgcttggcaaggcacgctggtgtgcgacgattacgtg
gcctacaagcagctgttcacgcagggcatcatggagtccggctgcatggcgcacgccaga
cgtcacctcttcgagttgcatgtcaatcaccagagccagattgccgctcaagcgctgcac
tacatcgcccagctctacgagatcgagcgcgaggtcaaaaccctgcgcgcggatgaacgc
caacgcatccgccaggcccggtcaaaaccgctggccgatgcgctgcaccaatggatggtg
cttgagcgcagccagatactggacggctcagccacggccaaggcactcgattacagcctc
aggcgctggggcgcgctcatgcgtttcctggatgacgggcaattaccgatcgacaacaac
tgggtggaaaaccaaatccggcccgtggcaatggcgtgttcataa

DBGET integrated database retrieval system