KEGG   Polaromonas naphthalenivorans: Pnap_0419Help
Entry
Pnap_0419         CDS       T00459                                 

Definition
(GenBank) transposase, IS4 family
Organism
pna  Polaromonas naphthalenivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(435689..436183)
Genome map
AA seq 164 aa AA seqDB search
MCIGDRESDMLEMMVKARDLGYPADYLVRSQHNRVLPSGGKLWDKVMAQPPVGRIRFMLP
AGRGRKSRTVEQDIRIERVQLSDKAKGAIEVSCLVASEVNAPAGVKPVVWRLLSNRVAST
LEQASELIDWYRSRWEIELFFLILKEGCRVERLQLSDKDIDPAQ
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
gtgtgcatcggcgaccgcgagtcggacatgctggagatgatggtcaaggcgcgcgatctg
ggctacccggctgactacttggtgcgcagtcagcacaaccgggtgctgccaagcggcggc
aagctgtgggacaaggtgatggcgcaaccgccagtcgggcgcatccgcttcatgctgcca
gccggacgaggccgaaagagccgcacggtcgagcaggacatccgcattgagcgcgtccag
ctgagcgacaaggccaaaggggccatcgaggtcagctgcctggtggcctcggaggtcaac
gccccggcaggcgtcaagcccgtggtctggcggctgctgagcaaccgcgtggccagcaca
ctggaacaggccagcgagctgatcgactggtaccgctcgcgctgggaaattgagctgttt
ttcttgattctcaaggagggctgccgagtcgagcggctgcagctgagcgacaaagatatt
gatccggcccaatga

DBGET integrated database retrieval system