KEGG   Polaromonas naphthalenivorans: Pnap_0420Help
Entry
Pnap_0420         CDS       T00459                                 

Definition
(GenBank) transposase IS116/IS110/IS902 family protein
Organism
pna  Polaromonas naphthalenivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transposase_20 DEDD_Tnp_IS110 Lzipper-MIP1
Motif
Other DBs
NCBI-ProteinID: ABM35742
UniProt: A1VJB4
Position
complement(436531..437613)
Genome map
AA seq 360 aa AA seqDB search
MNATTVAVDLAKSVFQLAVADASWRVVETHRLTRTQFERWFVNRDVSLVIMEACGSALHW
ARWLNGLGIEVRLLPAQYVRAYVKRNKTDAADAAALLEAARASDIRPVRIKSVEQQALQG
MHRIRSLWMGTRTSRINALRGFCREFGIAIPVGARTGIEAISRVLADPHTAVPDLIRGTA
KLLIEEIRLLEARIAQLERELASLARLCPACTTLLSIPGIGLLTATAMVAATSGDVSHFK
DARHFSSWFGLTPKEYSSGNSRYLGRISKKGDRYLRMLLTHGARSVLRAAKVAEGSGKEV
CGVRRWALDVQTRGNHNKAACALANKLARICYATLRDKEPFDEGQRLNKKINRESFVMPA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctactaccgttgccgtcgatcttgcaaagtccgttttccagctcgccgtcgcc
gatgcgtcttggcgggtcgtggaaacacaccgccttacgcgtacccagttcgagcgctgg
ttcgtcaaccgggatgtgagtctggtcatcatggaagcctgcggctcggccctccactgg
gcacgctggctcaatggtctgggcattgaggttcgactactcccagcccagtacgtccgt
gcctatgtcaaacgcaacaagaccgatgctgccgatgcagcggcgctgctcgaagccgcc
cgggcgtcggatattcgcccggtacgaatcaagtcagtcgagcaacaggcactgcaaggc
atgcaccgcatccgcagcttgtggatgggaacgcgtacctcgcgcatcaatgccttgcgt
ggtttttgccgggagtttggcattgcgattcccgtaggcgcgcgcactggcatcgaagcc
atcagtcgggtgctggctgacccccatactgcggtgcccgatctgattcgggggacagcc
aaattgctgattgaagaaatacgcctgctcgaagctcgcattgctcaactggagcgcgaa
ctggcatccctggccaggctgtgcccggcatgcaccacgctgctctcgataccaggcatt
ggcttgctcacggccactgcaatggtggcggctacatctggcgatgtcagtcacttcaag
gacgcacggcatttctccagttggtttggcttgacgcccaaggagtacagctcgggcaat
agccgttacctggggcgcatttccaagaagggagatcgctatctacgaatgctgctcact
cacggggccagaagtgtgctgcgtgccgccaaggtggctgagggttccggcaaagaagtt
tgtggtgtgcgccgttgggcgctggatgtgcagaccaggggcaaccacaacaaggcggct
tgtgcgctggccaacaagctggcgcggatttgctatgccacgctcagagacaaggagccg
tttgatgaaggccagcggctgaacaagaagatcaacagggagagctttgtgatgccggcc
tga

DBGET integrated database retrieval system