KEGG   Polaromonas naphthalenivorans: Pnap_0429Help
Entry
Pnap_0429         CDS       T00459                                 

Definition
(GenBank) Integrase, catalytic region
  KO
K07497  
putative transposase
Organism
pna  Polaromonas naphthalenivorans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(444542..445519)
Genome map
AA seq 325 aa AA seqDB search
MSRQCVLAGISRAALYARRKPKRIVQDDELLLRLIDEEYTRHPFYGSRKMVVHLGRCGHS
VNRKWAQRLMRSLGLAGMAPGPNTSRAHPQHKVYPYLLRGVAISRPNQVWSTDITYIRLA
RGFAYLVAVIDWYSRRVLSWRISNSMETVFCVDCLEEALRIHGKPEVFNTDQGSQFTSEA
FTSVLKREGVIISMDGRGRALDNIFVERLWRSVKHEDVYLKGYSAMGELLIGLTQYFTFY
NGERPHQALKNLTPDVVYQRAQGGGAMIVDKYGAAQSLPMALRSTGTAFDEVRLALLCHV
THADAGLSWRCSEGTERKSRDEAWR
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
ttgagccgccaatgcgtcctggcaggcatctcacgcgccgcgctgtacgcgcggcgaaag
cccaagcggatcgttcaggacgatgagttgctcttgcgtctgattgacgaggagtacacc
cgccatccgttttacgggagccgcaagatggtggtgcatctggggcgctgcggccacagc
gtcaaccgcaaatgggcacagcgcctgatgcgctcgctgggcctggcgggcatggcgccc
ggccccaataccagccgggcgcacccgcagcacaaggtgtacccgtacctgctgcgcggc
gtggcgatcagtcggcccaaccaggtctggagcaccgacatcacttacatccggctggcc
cgcggctttgcctatctggtggcggtcatcgactggtactcccggcgggtgttgagctgg
cgcatcagtaacagcatggagacggtgttctgcgtggactgtctggaggaggctttgcgc
attcacggcaagcctgaagtcttcaacaccgaccagggctcgcagttcaccagtgaggcc
ttcaccagtgtgctcaaacgcgagggcgtcatcatcagcatggacggtcgaggtagagcg
ttggacaatatttttgtcgagcggctctggcgcagcgtcaagcacgaggacgtgtacctc
aagggctatagcgcaatgggcgagttactgatcggcttgacgcaatacttcacgttttac
aacggtgaacgcccgcatcaagcgctgaagaatctgacacccgatgtggtgtaccagcgt
gctcaagggggtggcgccatgatcgtggacaaatatggcgccgcacagagcctcccaatg
gcgctgcgctccacaggcactgcgttcgatgaagtccgattagcactactctgccatgtc
actcacgccgacgcaggtctatcgtggcgctgcagtgagggcaccgaacgtaaatcacgg
gatgaagcatggcgatga

DBGET integrated database retrieval system