KEGG   Polaromonas naphthalenivorans: Pnap_0446Help
Entry
Pnap_0446         CDS       T00459                                 

Definition
(GenBank) D-alpha,beta-D-heptose 1,7-bisphosphate phosphatase
  KO
K03273  
D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase [EC:3.1.3.82 3.1.3.83]
Organism
pna  Polaromonas naphthalenivorans
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Module
ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:pna00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    Pnap_0446
Enzymes [BR:pna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.82  D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase
     Pnap_0446
    3.1.3.83  D-glycero-alpha-D-manno-heptose 1,7-bisphosphate 7-phosphatase
     Pnap_0446
Lipopolysaccharide biosynthesis proteins [BR:pna01005]
 Unusual sugar
  Pnap_0446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
465564..466148
Genome map
AA seq 194 aa AA seqDB search
MGLTMKLVILDRDGTINSDSDDFVKTPEEWLPLPGALEAIARLNHAGWHVVIASNQSGLG
RGLFDVVSLNAMHAKMNKLLALQGGRIDAVFYCPHTADEHCHCRKPKPGLLEQIGTRFGV
PLKGVPMVGDSLRDVVAGAAAGCEPHLVLTGKSQKYRGMAPPEGLPDGTLVHQDLAAFAD
FVLARAAQSEAASR
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgggcctcaccatgaaactagtcatcctcgaccgcgacggcacgatcaacagcgacagc
gacgacttcgtcaagacgcccgaggagtggctgccgctgcccggtgcgctcgaagcgatt
gcgcggctcaaccatgccggctggcatgtggtgattgcctccaaccagtcgggactgggg
cgcggtctgttcgacgtggtctcgctcaatgccatgcatgccaagatgaacaagctgctg
gcgctgcagggcggacggatcgacgcggtgttttactgcccgcacaccgccgatgaacac
tgccactgccgcaagcccaagcccgggctgcttgagcagatcggcacgcgttttggcgtg
ccgctcaagggtgttcccatggtaggcgactcgctgcgcgatgtcgtcgcgggcgcggcc
gccgggtgcgagccgcacctggtgctgaccggcaaatcgcaaaaataccggggcatggcg
ccgcccgaaggcttgcccgatggaacgctggtgcaccaggatctggcggcatttgccgac
ttcgtcctggcgcgcgcggcccagtctgaagccgccagccgctga

DBGET integrated database retrieval system