KEGG   Polaromonas naphthalenivorans: Pnap_0451Help
Entry
Pnap_0451         CDS       T00459                                 

Definition
(GenBank) response regulator receiver protein
Organism
pna  Polaromonas naphthalenivorans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg HTH_17 MerR DUF3853
Motif
Other DBs
NCBI-ProteinID: ABM35773
UniProt: A1VJE5
Position
472320..472961
Genome map
AA seq 213 aa AA seqDB search
MLREPKTFEAAITATDFSSEDYCGTSYAAKVLGLSVATVQSLVEKGEIEAWKTLGGHRRI
SLHSLNAYLTKYSPQLSRADLHPKHRLRVLVVEDDEAARDLYRCHFEEWDLPVDCTWMSS
ALDALMDIASMRPDLLIADLSMPGVDGIEMLRTIKRNQHLADMQIVVISGMAVEAIAARG
GLPPQARLVQKPVNFDWLQGYVTALVMANAKWR
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgtgaacccaaaaccttcgaggcggccataaccgcgaccgatttttcaagcgag
gattactgcggcacgagttatgcggccaaggtgctcgggttgtctgtcgccacggtccag
tcgctggttgaaaaaggtgaaatcgaagcctggaagacgctgggcggccaccggcggatt
tccctgcattccctcaatgcctacctgaccaaatacagcccgcagctctcgcgggccgat
cttcatcccaagcaccgcttgcgcgtgctggtggtggaagacgacgaggccgcgcgggat
ttgtaccgctgccattttgaagagtgggatctgccggttgactgcacctggatgtcatcg
gcgctcgatgcgctgatggatatcgccagcatgcggccggatttgctcattgccgacttg
tcgatgccgggcgtcgatggcatcgagatgctcagaaccatcaaacgcaaccagcatctt
gcagacatgcagattgtggtgatcagcggcatggcggtcgaggccattgccgcccgtggc
ggccttccgccacaagcgcgcctggtgcaaaaaccggtcaattttgactggctgcaaggc
tacgtcaccgcactggtcatggccaatgccaaatggcgctga

DBGET integrated database retrieval system