KEGG   Polaromonas naphthalenivorans: Pnap_0900Help
Entry
Pnap_0900         CDS       T00459                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna00900  Terpenoid backbone biosynthesis
pna01100  Metabolic pathways
pna01110  Biosynthesis of secondary metabolites
pna01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pna00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Pnap_0900
Enzymes [BR:pna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Pnap_0900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: ABM36217
UniProt: A1VKN9
Position
complement(951061..951954)
Genome map
AA seq 297 aa AA seqDB search
MTRPIVSSRPLKALYDIPAPAKLNLFLHITGRRPDGYHLLQSVFMLIDWCDTLHFELRTD
GQISRTDLNSPAQNNFEALPAEDLAVRAARALQAASGTPLGVHISLEKNIPSQAGMGGGS
SDAASCLLALQRLWGVRLPSQDLRAIALSLGADVPFFLSGSHAWVEGIGEQITPITLPAA
RFVVLKPAAGVSTPDIFNAPDLKRDTKTATMLGFAAYADGPVFGFGHNDLQPVAQKLCPQ
ISQSLDWLESQQLQGRMTGSGSAVFAQIFDDADLAAAPGNWIIRKCKNLQTHPLACW
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtgacacgccctatcgtttcttcacggccgctcaaggcgctgtacgacatcccggccccg
gccaagctcaaccttttcttgcacatcaccggccgcaggcccgatggctaccatttgctg
caatcggttttcatgctgatcgactggtgcgataccctgcactttgaactgcgcaccgat
gggcagatcagccgcaccgacctgaacagccctgcgcaaaataatttcgaagcgctgccc
gccgaagatctggccgtgcgcgcagcccgggcattgcaggcggccagcggcacgcccctg
ggtgtccatatcagccttgaaaaaaatattccctcgcaggcaggcatgggtggcggctcg
tccgatgcggccagttgcctgctggcgctgcagcgcctttggggagttcgcctgccgtct
caagacctgcgcgccatcgcactgtcgctgggcgcggacgttccctttttcctctctgga
agtcatgcctgggtggaaggaataggcgaacaaatcacgcccatcacactgccggcggcg
aggtttgtggtgctcaaaccggcagccggagtctcgaccccagatattttcaatgcacca
gatctgaaacgcgacactaagactgctacaatgctaggctttgctgcatatgcagatggt
ccggttttcggatttggccataacgacttgcagccggtagcgcagaagctttgtccgcaa
attagtcagtcacttgactggttagaatcgcaacagcttcagggacgcatgactggctcg
ggaagtgctgtatttgcacagatttttgatgatgctgatcttgcagccgcccctggcaac
tggataattcgcaaatgcaaaaatctgcaaacgcatcctctggcctgctggtaa

DBGET integrated database retrieval system