KEGG   Polaromonas naphthalenivorans: Pnap_0912Help
Entry
Pnap_0912         CDS       T00459                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pna  Polaromonas naphthalenivorans
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pna00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Pnap_0912
Enzymes [BR:pna01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Pnap_0912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
965291..966013
Genome map
AA seq 240 aa AA seqDB search
MLMKTTPPSQDLTDEGTPVSVKIRERLVMARKRFHANDNIAEFIEPGEMEKLLDEVEIKM
QGVLDSMVIDTVGDHNTGNTARRVAKMYLKEVFNGRYVTAPTITEFPNAEHLNELMIVGP
ITVRSACSHHFCPVIGKIWIGVLPNEHTNVIGLSKYARLAEWVMGRPQIQEEAVVQLADL
IMEKTQPDGLAIVMEASHYCMAWRGVKDMDSKMINSVMRGVFLKDSTLRREFLALIPRKG
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgcttatgaaaactactccgccctcacaggatctgacagacgaaggaacacctgtctcc
gtcaagatccgcgaacgcctggtcatggcacgcaagcgtttccatgccaatgacaacatc
gccgaattcatcgagccgggcgagatggaaaaattgcttgacgaggtcgagatcaagatg
cagggcgttctggacagcatggtgatcgacaccgtgggcgaccacaacaccggcaacacg
gcgcgccgggttgccaagatgtacctgaaagaggtcttcaatggccggtatgtgacggcg
ccgaccatcaccgaattccccaatgcagagcacctgaacgagttgatgatcgtcgggcca
atcaccgttcgcagcgcctgctcgcaccatttctgcccggtcatcggcaagatctggatt
ggcgttctgcccaacgagcataccaacgtgatcggcctgtccaaatacgcgcggctggcc
gagtgggtcatgggccgtccgcaaatccaggaagaggccgtggtgcaactggccgacctg
atcatggaaaaaacccagcccgacgggctggccatcgtgatggaagccagccactactgc
atggcctggcgcggcgtcaaggacatggacagcaagatgatcaactcggtcatgcgcggc
gtgttcctgaaggattcgaccttgcgccgcgagtttctcgcgcttattccaagaaaaggg
taa

DBGET integrated database retrieval system