KEGG   Polaromonas naphthalenivorans: Pnap_0927Help
Entry
Pnap_0927         CDS       T00459                                 

Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
pna  Polaromonas naphthalenivorans
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pna00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pnap_0927
   01230 Biosynthesis of amino acids
    Pnap_0927
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pnap_0927
  Energy metabolism
   00680 Methane metabolism
    Pnap_0927
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pnap_0927
Enzymes [BR:pna01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Pnap_0927
Exosome [BR:pna04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Pnap_0927
  Exosomal proteins of melanoma cells
   Pnap_0927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(978227..978979)
Genome map
AA seq 250 aa AA seqDB search
MYKLVLIRHGESTWNLDNRFTGWTDVDLTETGIAQAKNSGQLLKAEGYDFDLAYTSVLKR
ATRTLWHVLDEMDQTWLPVEHSWRLNERHYGDLQGLNKAETAKKFGDEQVLVWRRSYDTP
PPPLAANDPRSERSDRRYANLLPGQVPLTECLKDTVERVLPFWNEAMAPAIKAGKRIVVA
AHGNSIRALVKYLDNISDSDIVGLNIPNGIPLVYELDENLKPLRSYYLGDSEAAAKAAAA
VGAQGKAVAA
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaactcgtgctcatacgccacggcgaatcaacctggaacctggacaaccgcttt
accggctggaccgacgtcgatctgaccgaaaccgggattgcgcaggccaaaaattccggc
cagttgctcaaggccgaaggctatgactttgacctggcctataccagcgtgctcaagcgc
gccacccgcacactctggcatgtgctcgacgagatggaccagacctggctgccggtggag
cacagctggcggctcaacgagcgccattacggcgacctgcaggggctgaacaaggccgag
acggcgaaaaagttcggcgacgagcaggtgctggtctggcgccgcagctacgacacgccg
ccgccgccgctggcggccaatgacccccgcagcgaacgcagcgaccggcgctacgccaat
ctgctgcccggacaggtgccgctgaccgaatgcctgaaggacacggtggagcgcgtcctg
cccttctggaacgaagccatggccccagccatcaaggcaggcaagcgcatcgtggtggcg
gcgcacggcaactcgattcgcgcgctggtgaagtatctggacaatatctcggacagcgac
atcgtcggcctgaacattcccaacggcattccgctggtctatgaactcgacgagaacctc
aagccgctgcgcagctactacctgggcgacagcgaagccgccgccaaagccgctgcggcg
gtgggcgcgcagggcaaggccgttgcagcatga

DBGET integrated database retrieval system