KEGG   Polaromonas naphthalenivorans: Pnap_1071Help
Entry
Pnap_1071         CDS       T00459                                 

Definition
CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
pna  Polaromonas naphthalenivorans
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:pna02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:pna02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1137922..1138521)
Genome map
AA seq 199 aa AA seqDB search
MKPLNPAQRQSVEAVVIGASAGGVQALLALFSGLPAGFRLPLMVVLHLPEDRDSKLAEIF
QHRLPIPVREAADKERIAPGTLYFAGPGYHLSVERDRTFSLSGEEPVHYSRPSIDVLMES
AVDAYGDRLAGILLTGANADGAAGLAKIGEQGGLTVVQDPAEAQAPTMPEAAIRMRQPHL
ILTLDGIRSLLHQLDTSSC
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccctgaaccctgcacaaaggcaaagcgtcgaagcggtcgtgattggcgcttcg
gccggcggcgtgcaggccctgctggccttgttctccggcttgccagccggctttcgcctg
cccctgatggtggtgctgcatttgcccgaagaccgggacagcaagctggccgagattttt
cagcaccgcttgccgattccagtgcgcgaagccgccgacaaggaacgcatcgcaccggga
accctgtatttcgccgggccgggctaccacctgtcggtggaaagggaccggactttttca
ttgagcggcgaagaaccggtgcattactcgcgcccctcgattgacgtgctgatggagtct
gccgtggacgcttatggtgaccgcctggccgggattttgctcaccggcgccaacgccgac
ggcgccgccggactggctaaaataggcgaacaaggcgggctcacggtggtgcaggatcct
gccgaagcccaggcacccaccatgcccgaagcggccatccgcatgcggcaaccccatttg
attctcactctggacggcatccgcagcctgctccaccaactagatacatcctcatgctga

DBGET integrated database retrieval system