KEGG   Polaromonas naphthalenivorans: Pnap_1102Help
Entry
Pnap_1102         CDS       T00459                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pna  Polaromonas naphthalenivorans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pna00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Pnap_1102
Enzymes [BR:pna01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Pnap_1102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1171388..1172893)
Genome map
AA seq 501 aa AA seqDB search
MTFPRASGVLLHPTSLPGPHGCGDLGPAAYHFVDWLVTAKQRLWQILPLGGIGPGNSPYM
SSSAFAGNLLLIDLAELQQHGWLDEADLLPDAGFSDARVHFGAVVPWRMARLEKAAASFA
HNISAADQVDYADFCLHHAVWLEDYALFMTLAELHGGRDWCDWPAPLARRAPQALQDASA
AHAERIAFWKFGQWCFYRQWKKLRAHANERGVKIVGDAPIFIAFQSAEVWARQELFELDA
DGRATVIAGVPPDFFSATGQRWGNPLYRWSAHADEGYAWWIERVRRIFELVDIVRIDHFR
GFAGYWEIPASEPNAIRGRWLPGPGPALFHAIEAALGELPIIAEDLGVITPDVDALRHEF
SLPGMRILQFAFGEDGANDNTNAYLPHNFERNTVVYTGTHDNNTTQGWWAEASPALRQYV
LDYLGTGDGHDIHWQLIRAACASVADTAIHPLQDVLGLGAEHRMNLPGQGEGYWEWRFGW
DQVQPFHAERLARLGSLYRRE
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgacctttccccgcgccagcggcgtgctgctgcaccccacctccctgcccggcccgcac
ggctgtggcgacctcggaccggccgcttatcacttcgtggactggctggtgacggcgaag
cagaggctctggcagatcctgccgctgggcggcatcggccccggcaactcgccctacatg
agcagttcggcctttgccggcaacctgctgctgatcgacctggccgagctgcagcagcac
ggctggctcgatgaagccgatttgctgcccgacgccggcttcagcgatgcccgcgttcat
ttcggcgccgtcgtgccgtggcgcatggcgcggcttgaaaaagccgcagcaagctttgcg
cacaacatcagcgccgccgaccaggtggactacgcggacttttgcctgcaccacgccgtc
tggctggaggactacgccctgttcatgacgctggccgaactccacggcgggcgcgactgg
tgcgactggcccgcgccgctggcccgccgcgcgccgcaggccctgcaggatgccagcgcc
gcgcatgccgaacgcatcgccttctggaaattcggccagtggtgtttttaccggcaatgg
aaaaaactgcgcgcccatgccaacgagcgtggcgtgaagatcgtcggcgacgcgcccatc
ttcatcgccttccagagcgccgaagtctgggcgcgccaggaattgttcgaactcgatgcc
gatggccgggcaacggtcatcgccggcgtgccgcccgatttcttcagcgccaccggccag
cgctggggcaacccgctgtaccgctggagcgcccatgcggacgagggctatgcctggtgg
atcgagcgcgtgcggcgcattttcgagctggtggacatcgttcgcatcgaccatttccgg
ggctttgccggctactgggaaatcccggccagcgagcccaacgccatccgggggcgctgg
ctgcccggccccggcccggcgctgttccatgccatcgaagccgccctgggcgagttgccc
atcattgccgaagacctcggcgtcatcacgcccgacgtggacgcattgcgccatgaattc
agcctgcccggcatgcgcatcctgcagttcgcctttggcgaggatggcgccaacgacaac
accaacgcctacctgccgcacaacttcgagcgcaacaccgtcgtctataccggcacgcac
gacaacaacaccacgcaaggctggtgggctgaagcctcgcccgccctgcgccaatacgtg
ctggactacctgggcacgggcgacggccacgacatccactggcaactgatccgcgccgcc
tgcgccagcgtcgccgacaccgcgatccacccgctgcaggatgtgctgggcctgggcgcc
gagcaccgcatgaacctgcccggccagggcgaaggttactgggaatggcgctttggctgg
gaccaggtgcagcccttccatgccgaacggctggcccggctgggcagcctgtaccggcgc
gaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system