KEGG   Polaromonas naphthalenivorans: Pnap_1102Help
Entry
Pnap_1102         CDS       T00459                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pna  Polaromonas naphthalenivorans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pna00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1171388..1172893)
Genome map
AA seq 501 aa AA seqDB search
MTFPRASGVLLHPTSLPGPHGCGDLGPAAYHFVDWLVTAKQRLWQILPLGGIGPGNSPYM
SSSAFAGNLLLIDLAELQQHGWLDEADLLPDAGFSDARVHFGAVVPWRMARLEKAAASFA
HNISAADQVDYADFCLHHAVWLEDYALFMTLAELHGGRDWCDWPAPLARRAPQALQDASA
AHAERIAFWKFGQWCFYRQWKKLRAHANERGVKIVGDAPIFIAFQSAEVWARQELFELDA
DGRATVIAGVPPDFFSATGQRWGNPLYRWSAHADEGYAWWIERVRRIFELVDIVRIDHFR
GFAGYWEIPASEPNAIRGRWLPGPGPALFHAIEAALGELPIIAEDLGVITPDVDALRHEF
SLPGMRILQFAFGEDGANDNTNAYLPHNFERNTVVYTGTHDNNTTQGWWAEASPALRQYV
LDYLGTGDGHDIHWQLIRAACASVADTAIHPLQDVLGLGAEHRMNLPGQGEGYWEWRFGW
DQVQPFHAERLARLGSLYRRE
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgacctttccccgcgccagcggcgtgctgctgcaccccacctccctgcccggcccgcac
ggctgtggcgacctcggaccggccgcttatcacttcgtggactggctggtgacggcgaag
cagaggctctggcagatcctgccgctgggcggcatcggccccggcaactcgccctacatg
agcagttcggcctttgccggcaacctgctgctgatcgacctggccgagctgcagcagcac
ggctggctcgatgaagccgatttgctgcccgacgccggcttcagcgatgcccgcgttcat
ttcggcgccgtcgtgccgtggcgcatggcgcggcttgaaaaagccgcagcaagctttgcg
cacaacatcagcgccgccgaccaggtggactacgcggacttttgcctgcaccacgccgtc
tggctggaggactacgccctgttcatgacgctggccgaactccacggcgggcgcgactgg
tgcgactggcccgcgccgctggcccgccgcgcgccgcaggccctgcaggatgccagcgcc
gcgcatgccgaacgcatcgccttctggaaattcggccagtggtgtttttaccggcaatgg
aaaaaactgcgcgcccatgccaacgagcgtggcgtgaagatcgtcggcgacgcgcccatc
ttcatcgccttccagagcgccgaagtctgggcgcgccaggaattgttcgaactcgatgcc
gatggccgggcaacggtcatcgccggcgtgccgcccgatttcttcagcgccaccggccag
cgctggggcaacccgctgtaccgctggagcgcccatgcggacgagggctatgcctggtgg
atcgagcgcgtgcggcgcattttcgagctggtggacatcgttcgcatcgaccatttccgg
ggctttgccggctactgggaaatcccggccagcgagcccaacgccatccgggggcgctgg
ctgcccggccccggcccggcgctgttccatgccatcgaagccgccctgggcgagttgccc
atcattgccgaagacctcggcgtcatcacgcccgacgtggacgcattgcgccatgaattc
agcctgcccggcatgcgcatcctgcagttcgcctttggcgaggatggcgccaacgacaac
accaacgcctacctgccgcacaacttcgagcgcaacaccgtcgtctataccggcacgcac
gacaacaacaccacgcaaggctggtgggctgaagcctcgcccgccctgcgccaatacgtg
ctggactacctgggcacgggcgacggccacgacatccactggcaactgatccgcgccgcc
tgcgccagcgtcgccgacaccgcgatccacccgctgcaggatgtgctgggcctgggcgcc
gagcaccgcatgaacctgcccggccagggcgaaggttactgggaatggcgctttggctgg
gaccaggtgcagcccttccatgccgaacggctggcccggctgggcagcctgtaccggcgc
gaatga

DBGET integrated database retrieval system