KEGG   Polaromonas naphthalenivorans: Pnap_1104Help
Entry
Pnap_1104         CDS       T00459                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pna  Polaromonas naphthalenivorans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:pna00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Pnap_1104
Enzymes [BR:pna01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Pnap_1104
Exosome [BR:pna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Pnap_1104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1174988..1177177)
Genome map
AA seq 729 aa AA seqDB search
MLNPQEIELICSARHGDPFSVLGPHAQDGGLSIRAFLPNARQVEVIDACSGHRLGMLEKH
HPDGFFEGVLALQASAAYGLQVQWDNYQTALIEDPYRFGPVLGEVDVWLLSEGTHLRPYE
ILGANQRVMDGVAGTSFAVWAPHAARVSVVGDFNVWDGRRHPMRLRRECGVWEIFLPGVA
LGARYKFEILAADGQVLPARADPYARQAELRPATASIVAGMPALKPPSNERRQANALDAP
MSIYEVHLGSWRRILDPASGWQRWLNWDELADQLVPYALDMGFTHLELLPVSEHPFDGSW
GYQPVGLYAPTSRFGDADGLVRFIARCHASGIGVLLDWVPAHFPTDAHGLGNFDGTPLYE
YADPREGFHNDWNTLIYNLGRTEVRNFLIGNALYWLERFDVDGLRVDAVASMLYRDYSRK
PGEWIPNRHGGRENLETIDFLKRMNDIVVQERPQAVTMAEESTSFPGVSRPTTAGGLGFH
YKWNMGWMHDTLQYMARDPVHRQHHQGEMTFGLAYAFSENFVLPISHDEVVHGKGSLLGK
MPGDRWQQFANLRAYLGFMFGHPGKKLLFMGCEFAQLREWNHDQSLDWHLLDDPQHAGVQ
RLVRDLNQLYRATPALYQLDFVPAGFEWMDHQDAAHSVLAFIRRGLDARSFILVVCNFTP
TVQTAYRVGVPQPGEYRERLNTDSAHYGGSNAGTPLGAATAEPVGWHGQPQSLLLNLPPL
ATVVFEWTA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctgaacccgcaagagattgaactgatttgcagcgcccgccacggcgacccgttctcg
gtgctggggccgcatgcgcaggacggtggcctgtccatccgcgccttcctgcccaacgcc
cggcaggtcgaggtgattgatgcctgctcgggccatcggctcggcatgcttgagaaacac
catcccgacggatttttcgaaggcgttctggcgctgcaggcatcagcggcttacggattg
caggtgcagtgggacaactaccagacggccctgattgaagacccctaccgcttcgggccg
gtgctgggcgaggtggatgtctggctgctcagcgaaggcacgcacctgcggccctatgag
attttgggcgccaaccagcgcgtgatggacggcgtggccggcaccagctttgccgtgtgg
gcgccgcatgccgcgcgcgtcagcgtggtgggcgacttcaatgtctgggacggccggcgc
cacccgatgcggctgcggcgcgagtgcggcgtctgggagattttcctgcccggcgtggcg
ctgggcgcgcgctacaagtttgaaatcctcgccgccgatggccaggtgctgccggcccgc
gccgacccgtatgcgcgccaagccgaattgcgcccggccacggccagcatcgtggcaggc
atgccggcgctcaagcctccttcaaatgaacgccggcaagccaatgcgctggatgcgccg
atgagcatctacgaagtccacctgggttcgtggcggcgcatccttgacccggccagcggc
tggcagcgctggctgaactgggacgaactcgccgaccagctggtgccctacgcgctggac
atgggttttacccaccttgaactgctgccggtcagcgaacatccgtttgacggctcctgg
ggctatcagccagtcggcctgtatgcgcccacgtcgcgttttggcgatgccgacggcctg
gtgcgtttcatcgcgcgctgccacgcgtcgggcatcggcgtgctgctcgactgggtgccg
gcgcactttccgaccgacgcgcacgggctgggcaattttgacggcacgccgctgtacgaa
tacgccgatccgcgcgaaggctttcacaacgactggaacacgctgatctacaacctgggc
cgcaccgaggtgcgcaacttcctgatcggcaacgcgctgtactggctggagcgcttcgat
gtcgatggcctgcgcgtcgatgcggtggcgtcgatgctctaccgcgactacagccgcaag
cccggcgaatggattcccaaccggcatggcgggcgcgagaacctggaaaccatagacttc
ctcaagcgcatgaacgacatcgttgtccaggagcggccgcaagccgtcaccatggccgaa
gaatcgacctcgtttcccggcgtgtcgcgcccgacgacggccggcggcctgggttttcac
tacaagtggaacatgggctggatgcatgacacgctgcagtacatggcgcgcgacccggtg
catcgccagcatcaccagggcgaaatgacgttcggcctggcctatgccttcagcgaaaac
ttcgtgctgccgatctcgcacgacgaggtggtgcatggcaagggctcgctgctgggcaag
atgcccggcgaccgctggcagcagttcgccaacctgcgcgcctacctgggcttcatgttc
ggccaccccggcaagaagctgctgttcatgggctgcgaattcgcgcagctgcgcgaatgg
aaccacgaccagagcctggactggcacctgctggatgacccgcaacacgccggcgtgcag
cgcctggtgcgcgacctaaaccagctctaccgcgccaccccggcgctgtaccagctcgac
tttgtacctgccggttttgagtggatggaccaccaggatgccgcgcattcggtgctcgcc
ttcatccggcgcggcctggatgcacggagttttattttggtggtctgcaacttcaccccc
accgtgcagacggcttaccgcgtcggcgttccccagcccggcgaataccgcgagcggctc
aacaccgactcggcccattacggcggcagcaatgccggcacgccgctgggcgccgccacg
gcggaacccgtgggctggcacggccagccgcagtcccttttgctgaacctgccgccgctg
gccaccgtggtgttcgaatggaccgcttga

DBGET integrated database retrieval system