KEGG   Polaromonas naphthalenivorans: Pnap_1128Help
Entry
Pnap_1128         CDS       T00459                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pna  Polaromonas naphthalenivorans
Brite
Enzymes [BR:pna01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Pnap_1128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1201054..1201743)
Genome map
AA seq 229 aa AA seqDB search
MNYEQARFNMIEQQIRPWEVLDNQVLSLLAVMRREDFVPPACKALAFTDMEIPLPPHKNP
GQCMLAPRVEARILQDLAVQKHEKVLEIGTGSGFMAALLAHRAQQVITLEIEPELAETAR
RNLQKAGIYNAEVRQADGAANLAEAVSGNGPLRGPFDVIVLSGSVAEVPAALLDQLKVGG
RLSAIVGDEPMMRATLITRVGKDSFRTTQAWDTVAPRLLNFPAPSKFTF
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgaactacgaacaagcccgattcaacatgattgagcagcaaatccgcccctgggaagtg
ctggacaaccaggtcctttccctgctcgcggtgatgcggcgcgaagacttcgtgccgccg
gcctgcaaggcgctggccttcaccgacatggaaatcccgctgccgccgcacaaaaacccc
ggccagtgcatgctcgcgccccgcgtcgaagcccgcatcctgcaagacctggccgtgcaa
aagcatgaaaaagtgctggaaatcggcaccggctccggtttcatggccgccctgctcgcg
caccgcgcccagcaggtcatcaccctggaaatcgagcctgaactggccgaaaccgcgcgc
cgcaacctgcaaaaagccggcatctacaacgccgaagtgcgccaggccgacggcgcggcc
aacctggccgaagccgtgtccggcaacggcccgctgcgcggccctttcgacgtgatcgtg
ctcagcggctcggtcgccgaagtgcccgccgcgctgctcgaccagctcaaggtcggcggc
cggctcagcgccatcgtcggcgacgagcccatgatgcgcgccacgctgatcacccgcgtc
ggcaaggactcattccgcactacccaggcctgggacacggtggcgccccggctgctcaat
ttccccgcgccgtcgaaattcactttctga

DBGET integrated database retrieval system