KEGG   Polaromonas naphthalenivorans: Pnap_1209Help
Entry
Pnap_1209         CDS       T00459                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
pna  Polaromonas naphthalenivorans
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pna00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:pna00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:pna02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1292126..1293928)
Genome map
AA seq 600 aa AA seqDB search
MSEVTSRREFLLKTAAAVVAGSSVVACGGSDDSTPVPPAQFTYGVASGDPLSDRVILWTY
AKVADSNASVPLTWQVATDSSFANIVSSGSVEALPANGFTAKVDATGLSAGASYFYRFRD
AAGTTSTVGATRTLPAASVASVKFAVFSCSLYSEGYFNAYADAARSDALYALHLGDYIYE
YGSDTAKYGNKDAVALGRVAAPASDIASLADYRQRYAQYKSDADLQALHAKMPWITIWDD
HEFANNAYKDGAENHNPATQGDWATRKAMAAKAYHEWLPIRTADTANLLKIYRHFDFGKL
LSLHMLDTRIEGRDRQYDNFGDADGGIGRYITGLTPVGGVLPDASRRIISTAQQDWLTAG
LATSTATWQFLGNQDIMARMWFPASVLRKQAAAFASPPTATLADVTAAINDYLTAKATRA
AAGPGALTPTQAALLDPAINPTLPYNLDAWDGYPTQRDAILTTVKNMNKQLVVLSGDSHN
GWFTQLTTLAGVKAGVEFAGSSVSSTGFEAVGLGELASSLDGSVLVPQLGTAAIGAGLGL
VDDLGYVDTKRRGYLLMTVTAASVKGEYVFVNTVKSKTYTASIGKTITVTSAGVVSYGDA
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaagttaccagccgccgtgagtttttgctgaaaacggcagctgccgttgtcgcg
ggcagttcagtcgtggcctgcggcggcagcgacgacagcacgcccgtgcctccggcgcaa
ttcacctatggcgtggccagcggcgacccactgtctgatcgcgtgatcctgtggacttac
gccaaagtcgctgacagcaatgcctccgtgccgctgacctggcaagtggccactgacagc
agcttcgccaatatcgtcagctccggctcggtcgaggcgctgccggccaacggcttcacc
gccaaggtcgatgccaccggcctgagcgcaggcgcgagttacttctatcgctttcgcgat
gcggccggaaccacttccaccgtcggcgccacgcgcaccctgccggccgcatcggtggcg
agcgtcaagttcgccgtgttctcctgctcgctgtactcggaaggctacttcaatgcctac
gccgatgccgccaggtcagacgcgctgtatgcccttcacctgggcgactacatctacgag
tacggctcggacacggccaaatacggcaacaaggacgccgtggcgctgggccgcgtggcg
gccccggccagcgacatcgccagcctggccgactaccgccagcgctatgcgcagtacaag
tcggatgccgatctgcaggccctgcacgccaaaatgccgtggatcacgatctgggacgac
cacgaattcgccaacaatgcctataaggatggcgctgaaaaccacaacccggccacccaa
ggcgactgggccacgcgcaaggccatggccgcgaaggcttaccacgagtggttgccgatc
cgcacggccgacacggccaatctgctgaaaatttaccgccacttcgatttcggcaagctg
ctgtcactgcacatgctcgacacccgcatcgagggccgcgaccgccagtatgacaacttc
ggcgacgccgatggcggcatcgggcgctacatcacgggtctgaccccggtgggcggcgtc
ctgcccgacgcctcgcgccgcattatcagcaccgcgcagcaggactggctgaccgctggc
ttggccacctccaccgccacctggcagttcctgggcaaccaggacatcatggcccgcatg
tggtttccggcgtcggtgctgcgcaagcaggcggccgccttcgcctcgccaccaacagcc
acactggccgatgtgacagccgccatcaatgattacctgaccgccaaggccacgcgcgca
gccgctggcccgggcgcgctgacgccaacccaggccgccctgctcgatccggcgatcaac
ccgaccctgccctacaacctggatgcctgggacggctacccgacccagcgcgatgcgatt
ttgaccactgtgaaaaacatgaacaagcaactggtggtgctgtcgggcgactcgcacaac
ggctggtttacccagctcaccacgctcgcgggcgtcaaggcgggcgtcgagtttgcaggc
agctcggtcagctcgaccggattcgaggccgtcggcctgggcgaactggcgtcttcgctg
gacggatcggtgttggtgccgcaactgggcacggcggccatcggcgccggcctgggcctg
gtggacgacctaggctacgtcgatacgaagcgccggggctacctcttgatgacggtgacc
gcagccagcgtcaagggcgaatatgtgttcgtcaatacggtcaagtcaaagacctacacc
gccagcatcggcaaaaccatcacggtcaccagcgcgggcgtcgtcagctacggcgacgcc
tga

DBGET integrated database retrieval system