KEGG   Polaromonas naphthalenivorans: Pnap_1422Help
Entry
Pnap_1422         CDS       T00459                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pna  Polaromonas naphthalenivorans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pna00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pnap_1422 (tpiA)
   01230 Biosynthesis of amino acids
    Pnap_1422 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pnap_1422 (tpiA)
   00051 Fructose and mannose metabolism
    Pnap_1422 (tpiA)
   00562 Inositol phosphate metabolism
    Pnap_1422 (tpiA)
Enzymes [BR:pna01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Pnap_1422 (tpiA)
Exosome [BR:pna04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Pnap_1422 (tpiA)
  Exosomal proteins of bladder cancer cells
   Pnap_1422 (tpiA)
  Exosomal proteins of melanoma cells
   Pnap_1422 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1511157..1511885
Genome map
AA seq 242 aa AA seqDB search
MNGSLTANEELLAALAAGLAQSPPCEIAVCVPAPYLAQIQSLKSKHAALSVVDVGAQDVS
AHASGAYTGEASAAMLKELGCRYVIIGHSERRQYHAETDALVAEKARAALAAGITPIVCV
GETLTEREAGRTEEVVKRQLAAVIHANGHCISEIVVAYEPVWAIGTGKTASPEEAQAVHA
VLRAQLKAATDQSARIKILYGGSMNAANAATLLAQPDIDGGLIGGASLKAPDFLKIIAAA
PV
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcagcttgactgccaatgaagaactgctggccgcgcttgctgccgggctggct
caaagcccgccctgcgagatcgccgtctgcgtgcctgcaccttacctggcacagattcag
tccttgaaatcgaaacacgcggccttgtctgtcgttgacgtgggcgcgcaggatgtatcc
gcccacgcttcaggcgcctacaccggcgaagccagtgcagccatgctcaaggaactgggg
tgccgctacgtcatcatcggtcattcggagcgccgtcagtaccacgccgaaactgatgca
ctggtggccgagaaggccagggctgcgctggctgcgggcatcacgcccatcgtctgtgtt
ggtgaaacattgaccgagcgcgaagccggccgtaccgaagaggtggtcaagcgtcaactg
gcggccgtcatccatgccaacgggcactgcatcagcgagatcgttgtcgcttatgagccg
gtttgggccatcgggaccggcaagaccgcctcgccagaggaggcacaggccgtgcatgcg
gtgctgagagcgcagctcaaggcggcaaccgaccagtcagcccgaatcaagattctgtat
ggcggcagtatgaatgcagctaacgctgcgactttgctggctcagcccgacattgatggc
ggcctgataggcggcgcttcgctcaaggcaccggattttttgaaaattattgctgctgcg
cccgtttga

DBGET integrated database retrieval system