KEGG   Polaromonas naphthalenivorans: Pnap_1422Help
Entry
Pnap_1422         CDS       T00459                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna00010  Glycolysis / Gluconeogenesis
pna00051  Fructose and mannose metabolism
pna00562  Inositol phosphate metabolism
pna01100  Metabolic pathways
pna01110  Biosynthesis of secondary metabolites
pna01120  Microbial metabolism in diverse environments
pna01130  Biosynthesis of antibiotics
pna01200  Carbon metabolism
pna01230  Biosynthesis of amino acids
Module
pna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pna_M00002  Glycolysis, core module involving three-carbon compounds
pna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pna00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pnap_1422
   00051 Fructose and mannose metabolism
    Pnap_1422
   00562 Inositol phosphate metabolism
    Pnap_1422
Enzymes [BR:pna01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Pnap_1422
Exosome [BR:pna04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Pnap_1422
  Exosomal proteins of bladder cancer cells
   Pnap_1422
  Exosomal proteins of melanoma cells
   Pnap_1422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Glyco_hydro_3_C
Motif
Other DBs
NCBI-ProteinID: ABM36736
UniProt: A1VM58
Position
1511157..1511885
Genome map
AA seq 242 aa AA seqDB search
MNGSLTANEELLAALAAGLAQSPPCEIAVCVPAPYLAQIQSLKSKHAALSVVDVGAQDVS
AHASGAYTGEASAAMLKELGCRYVIIGHSERRQYHAETDALVAEKARAALAAGITPIVCV
GETLTEREAGRTEEVVKRQLAAVIHANGHCISEIVVAYEPVWAIGTGKTASPEEAQAVHA
VLRAQLKAATDQSARIKILYGGSMNAANAATLLAQPDIDGGLIGGASLKAPDFLKIIAAA
PV
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcagcttgactgccaatgaagaactgctggccgcgcttgctgccgggctggct
caaagcccgccctgcgagatcgccgtctgcgtgcctgcaccttacctggcacagattcag
tccttgaaatcgaaacacgcggccttgtctgtcgttgacgtgggcgcgcaggatgtatcc
gcccacgcttcaggcgcctacaccggcgaagccagtgcagccatgctcaaggaactgggg
tgccgctacgtcatcatcggtcattcggagcgccgtcagtaccacgccgaaactgatgca
ctggtggccgagaaggccagggctgcgctggctgcgggcatcacgcccatcgtctgtgtt
ggtgaaacattgaccgagcgcgaagccggccgtaccgaagaggtggtcaagcgtcaactg
gcggccgtcatccatgccaacgggcactgcatcagcgagatcgttgtcgcttatgagccg
gtttgggccatcgggaccggcaagaccgcctcgccagaggaggcacaggccgtgcatgcg
gtgctgagagcgcagctcaaggcggcaaccgaccagtcagcccgaatcaagattctgtat
ggcggcagtatgaatgcagctaacgctgcgactttgctggctcagcccgacattgatggc
ggcctgataggcggcgcttcgctcaaggcaccggattttttgaaaattattgctgctgcg
cccgtttga

DBGET integrated database retrieval system