KEGG   Polaromonas naphthalenivorans: Pnap_1672Help
Entry
Pnap_1672         CDS       T00459                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pna  Polaromonas naphthalenivorans
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pna03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1768513..1769139
Genome map
AA seq 208 aa AA seqDB search
MADSNALDGLTQALRKLPGVGAKSAARMAFHLLQHDKPGALQIARALEHAVQSIRHCALC
NTLTEQEVCVTCANPQRDRSKLCVVETPADQAALERTLAYRGLYFVLMGKLSPLDGVGPN
DIGLQKLFDRAVPKDEHGQPLPAASREVQEVILATNFTAEGEATAHVIAQALKSRGMQVT
RLARGVPVGSELEYVDLGTIAHALTDRR
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
gtggcagattccaatgctcttgacggcctgacccaggcgttgcgcaagctgccgggcgtg
ggcgcgaagtcggctgcgcgcatggcgtttcacctgctgcagcacgacaagccgggggcc
ttgcagatcgcgcgtgcgctggagcatgcggtccagagcatccggcactgcgccctgtgc
aacaccctgaccgagcaggaggtgtgcgtgacctgcgccaatccccagcgcgaccgcagc
aagctgtgcgtggtcgaaacccccgccgaccaggcggcactggagcgaaccctggcctac
cgggggctgtacttcgtgctcatgggcaagctcagcccgctcgatggcgtcggccccaac
gacatcggcctgcaaaagctgtttgaccgcgccgtccccaaggacgagcacggccagccg
ctgccagccgcgtcgcgtgaagtccaggaagtcatcctggcgaccaatttcaccgccgaa
ggcgaggcgacggcgcatgtgattgcccaagccctgaaaagccgtggcatgcaggtcacc
cggctggcgcgcggcgttccggtgggcagcgaactcgaatatgtcgatctgggcacgatt
gcacacgcgttgacagaccgaaggtga

DBGET integrated database retrieval system