KEGG   Polaromonas naphthalenivorans: Pnap_1857Help
Entry
Pnap_1857         CDS       T00459                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna00020  Citrate cycle (TCA cycle)
pna00310  Lysine degradation
pna01100  Metabolic pathways
pna01110  Biosynthesis of secondary metabolites
pna01120  Microbial metabolism in diverse environments
pna01130  Biosynthesis of antibiotics
pna01200  Carbon metabolism
Module
pna_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pna_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pna00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pnap_1857
  Amino acid metabolism
   00310 Lysine degradation
    Pnap_1857
Enzymes [BR:pna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Pnap_1857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ABM37167
UniProt: A1VND9
Position
1980352..1981614
Genome map
AA seq 420 aa AA seqDB search
MAIVEVKVPQLSESVAEATMLQWKKKVGDAIAIDEILIEIETDKVVLEVPAPSAGVLIEL
VVADGGTVVSDQVIARIDTEGKAGATAPAAAAPTAATASVAAPAPVATGGSMAGVPMPSA
AKLMADNSLAAGSVPGTGKDGRVTKGDVLGATAAGATKSVAASAIPTGAPTTSLPKVASP
VKAVDLGERPEQRVPMSRLRARIAERLLQSQSTNAILTTFNEVNMAPVMDMRKKFQDAFS
KEHGVKIGFMSFFVKAAVHALKKFPMINASVDGNDIVYHGYFDIGIAVGSPRGLVVPILR
NADQMSFADIEKKIAEFGQKAKDGKLGIEEMTGGTFSISNGGTFGSMLSTPIINPPQSAI
LGVHATKDRAVVENGQIVIRPMNYLAMSYDHRIIDGREAVLGLVAMKEALEDPARLLFDI
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgtagaagttaaagttccccagttgtccgaatccgtggccgaagccaccatg
ctgcaatggaaaaagaaggtcggcgacgcaattgcaattgacgagatcctgattgaaatc
gaaaccgacaaggttgtcctcgaagtccccgcgccctcggccggtgtgctgattgagttg
gtggtggctgatggcggcacggtggtgtcggatcaggtgattgcaagaatcgataccgaa
ggcaaggccggtgcaacggcgcctgccgctgctgcgccaactgcggcaacagcatcggtg
gcagcaccggctccggttgcaacgggcggctccatggcgggcgttcccatgccttccgct
gccaagctgatggcggacaacagcctggcggcaggcagtgttcccggaaccggcaaggat
ggacgtgtcaccaagggtgatgttctgggtgctacggctgccggtgctactaaatcagta
gctgctagcgcaatcccgacgggcgcaccgaccacttccttgcctaaagtggcatcaccg
gtgaaagcggttgacctgggtgagcgtcctgagcagcgggttcccatgagccgtctgcgc
gcgcgcatcgctgagaggcttttgcaatctcaatcaaccaatgccatcttgacgaccttc
aacgaagtcaacatggccccggtgatggatatgcgcaagaagttccaggatgccttcagc
aaggagcatggcgtcaagatcggcttcatgagctttttcgtcaaagctgcggtgcacgcg
ctcaagaagttcccgatgatcaacgcatcggtggacggcaacgacatcgtctatcacggc
tactttgacattggcattgccgtcggttcgccgcgcggcctggtcgtgcctatcctgcgc
aatgcggatcagatgagctttgccgacatcgaaaagaaaattgctgaatttggccagaag
gccaaggatggcaagttgggcatcgaagagatgactggcggcacgttctcgatttccaat
ggcggaaccttcggttcgatgctttcaacacccatcatcaacccgccacagtccgcgatt
ctgggcgtgcatgcgaccaaagaccgtgcggttgtcgaaaatggccagatcgtgattcgt
ccgatgaactacctcgccatgagctacgaccaccgcatcatcgacggccgcgaggctgtg
ctgggtctggttgccatgaaagaggcgctggaagatccagcccgcctgctgttcgatatt
taa

DBGET integrated database retrieval system