KEGG   Polaromonas naphthalenivorans: Pnap_1857Help
Entry
Pnap_1857         CDS       T00459                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pna  Polaromonas naphthalenivorans
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:pna01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:pna00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:pna00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1980352..1981614
Genome map
AA seq 420 aa AA seqDB search
MAIVEVKVPQLSESVAEATMLQWKKKVGDAIAIDEILIEIETDKVVLEVPAPSAGVLIEL
VVADGGTVVSDQVIARIDTEGKAGATAPAAAAPTAATASVAAPAPVATGGSMAGVPMPSA
AKLMADNSLAAGSVPGTGKDGRVTKGDVLGATAAGATKSVAASAIPTGAPTTSLPKVASP
VKAVDLGERPEQRVPMSRLRARIAERLLQSQSTNAILTTFNEVNMAPVMDMRKKFQDAFS
KEHGVKIGFMSFFVKAAVHALKKFPMINASVDGNDIVYHGYFDIGIAVGSPRGLVVPILR
NADQMSFADIEKKIAEFGQKAKDGKLGIEEMTGGTFSISNGGTFGSMLSTPIINPPQSAI
LGVHATKDRAVVENGQIVIRPMNYLAMSYDHRIIDGREAVLGLVAMKEALEDPARLLFDI
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgtagaagttaaagttccccagttgtccgaatccgtggccgaagccaccatg
ctgcaatggaaaaagaaggtcggcgacgcaattgcaattgacgagatcctgattgaaatc
gaaaccgacaaggttgtcctcgaagtccccgcgccctcggccggtgtgctgattgagttg
gtggtggctgatggcggcacggtggtgtcggatcaggtgattgcaagaatcgataccgaa
ggcaaggccggtgcaacggcgcctgccgctgctgcgccaactgcggcaacagcatcggtg
gcagcaccggctccggttgcaacgggcggctccatggcgggcgttcccatgccttccgct
gccaagctgatggcggacaacagcctggcggcaggcagtgttcccggaaccggcaaggat
ggacgtgtcaccaagggtgatgttctgggtgctacggctgccggtgctactaaatcagta
gctgctagcgcaatcccgacgggcgcaccgaccacttccttgcctaaagtggcatcaccg
gtgaaagcggttgacctgggtgagcgtcctgagcagcgggttcccatgagccgtctgcgc
gcgcgcatcgctgagaggcttttgcaatctcaatcaaccaatgccatcttgacgaccttc
aacgaagtcaacatggccccggtgatggatatgcgcaagaagttccaggatgccttcagc
aaggagcatggcgtcaagatcggcttcatgagctttttcgtcaaagctgcggtgcacgcg
ctcaagaagttcccgatgatcaacgcatcggtggacggcaacgacatcgtctatcacggc
tactttgacattggcattgccgtcggttcgccgcgcggcctggtcgtgcctatcctgcgc
aatgcggatcagatgagctttgccgacatcgaaaagaaaattgctgaatttggccagaag
gccaaggatggcaagttgggcatcgaagagatgactggcggcacgttctcgatttccaat
ggcggaaccttcggttcgatgctttcaacacccatcatcaacccgccacagtccgcgatt
ctgggcgtgcatgcgaccaaagaccgtgcggttgtcgaaaatggccagatcgtgattcgt
ccgatgaactacctcgccatgagctacgaccaccgcatcatcgacggccgcgaggctgtg
ctgggtctggttgccatgaaagaggcgctggaagatccagcccgcctgctgttcgatatt
taa

DBGET integrated database retrieval system