KEGG   Polaromonas naphthalenivorans: Pnap_1888Help
Entry
Pnap_1888         CDS       T00459                                 

Definition
GDSL family lipase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
pna  Polaromonas naphthalenivorans
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:pna00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Pnap_1888
Enzymes [BR:pna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Pnap_1888
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Pnap_1888
Lipid biosynthesis proteins [BR:pna01004]
 Fatty acid synthase
  Component type
   Pnap_1888
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2011840..2012457)
Genome map
AA seq 205 aa AA seqDB search
MTALLGAPAFAQAQAKAPPAPPTVLIVGDSLSAEYGLRRGTGWVPLLEKQLASENKAAKV
VNASISGDTTSGGRSRLPALLAQHKPATVVIELGGNDALRGLPLDMTGNNLTAMTQAAKK
AGAKVLLVGMQVPPNYGSAYAATFSGLFAKVAKEEKVALVPFFLKGIADGDDAAANFQPD
RIHPNEPSQARMLANVWPELKKIIP
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgacggccttgctgggcgcgcctgcattcgcccaggcgcaggccaaggcgccaccggcc
ccgccaacggtcctgatcgtcggtgattcgctgagcgccgaatacggcctcaggcgaggc
actggttgggtgccgctgctcgaaaagcagctggccagcgagaacaaagccgccaaagtc
gtcaacgccagcatcagcggcgacaccacctcgggcggccgctcgcgcctgccggccctg
ctggcgcagcacaagccggccaccgtggtgatcgagctgggcggcaacgatgcgctgcgc
ggcctgcctctggacatgaccgggaacaacctgacggccatgacgcaggcggccaagaaa
gccggcgccaaggtactgctggtcggcatgcaggtgccgcccaactacggcagcgcctac
gcagcaaccttttccggcctttttgcgaaggtcgccaaggaggaaaaagtcgcgctggtg
ccttttttcctcaagggcattgccgatggcgatgatgccgccgccaatttccagcccgac
agaatccaccccaacgagccatcgcaagccagaatgctggccaatgtgtggcccgaactg
aagaaaatcatcccgtga

DBGET integrated database retrieval system