KEGG   Polaromonas naphthalenivorans: Pnap_2080Help
Entry
Pnap_2080         CDS       T00459                                 

Definition
ribokinase-like domain-containing protein
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
pna  Polaromonas naphthalenivorans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pna00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pnap_2080
   01230 Biosynthesis of amino acids
    Pnap_2080
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pnap_2080
   00030 Pentose phosphate pathway
    Pnap_2080
   00051 Fructose and mannose metabolism
    Pnap_2080
   00052 Galactose metabolism
    Pnap_2080
  Energy metabolism
   00680 Methane metabolism
    Pnap_2080
Enzymes [BR:pna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Pnap_2080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2213352..2214290
Genome map
AA seq 312 aa AA seqDB search
MTDILTVTMNPALDVSTSTDKVMDTHKLRCTAPIFHPGGGGINVARVLHRLGGDCLALYL
AGGMNGQRLRQLLDQEQVRGHCIAIAGETRESFSAHETSSGRDFRFVLPGPALTPGEWQA
GLDYISALGASPPYLVASGGLPPDVPEDFYARLARLAKARGSRVVLDTSGPALAAALAEG
VYLVKPSLRELRELTGHPLQTGPDQHAAALQIIRSGQAQVVALSLGEDGALLVTANRALR
ARSLPVPVASSIGAGDSFVGGLVWALSRHETLEQAFRYGMAAGAAALLAPGTALCQAADV
ERLHREVLITPA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacatcctgaccgtcaccatgaatcccgcgctcgacgtgtccacctcgaccgac
aaggtcatggacacgcacaagctgcgctgcacggccccgatatttcacccgggcggcggc
ggcatcaacgtggcccgcgtcctgcaccggctgggcggcgactgcctggcgctttatctg
gccggcggcatgaatgggcaacggctgcgccaactgctggaccaggagcaggtgcgcggc
cattgcatcgctattgccggcgagacgcgcgagagcttttcggcccacgaaacgtccagc
ggacgcgactttcgctttgtgctgcccgggcccgcattgacgcccggggaatggcaggcc
ggcctggactacatcagcgccttgggcgcatccccgccttacctggtggccagtggcggc
ttgccgcccgatgtccctgaagacttttacgcccggctggcccggctggccaaggcacgc
ggcagccgggtggtgctcgacacctcggggccggcgctggcggcggcattggccgaaggg
gtgtacctggtcaagcccagccttcgggaactgcgcgaattgaccggccatccgctgcaa
accgggccggaccagcatgcggcggcgctgcagatcatcaggagcggccaggcgcaggtc
gtagccctgtcgctgggcgaggatggcgcactgctggtgacggccaaccgggcgctgcgg
gccagaagcctgccagtgccagtcgccagctcgattggcgcgggcgacagcttcgtgggc
ggactggtctgggcactgagccggcatgaaacgctggagcaggcctttcgctacggcatg
gcggcgggcgcggccgccctgctcgcgccgggcacggcgctgtgccaggcggcggatgtg
gaacggctgcaccgggaagtgctcatcacccccgcttga

DBGET integrated database retrieval system