KEGG   Polaromonas naphthalenivorans: Pnap_2136Help
Entry
Pnap_2136         CDS       T00459                                 

Definition
(GenBank) beta-ketoadipyl CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna00071  Fatty acid degradation
pna00072  Synthesis and degradation of ketone bodies
pna00280  Valine, leucine and isoleucine degradation
pna00310  Lysine degradation
pna00362  Benzoate degradation
pna00380  Tryptophan metabolism
pna00620  Pyruvate metabolism
pna00630  Glyoxylate and dicarboxylate metabolism
pna00640  Propanoate metabolism
pna00650  Butanoate metabolism
pna00900  Terpenoid backbone biosynthesis
pna01100  Metabolic pathways
pna01110  Biosynthesis of secondary metabolites
pna01120  Microbial metabolism in diverse environments
pna01130  Biosynthesis of antibiotics
pna01200  Carbon metabolism
pna01212  Fatty acid metabolism
pna02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pna00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Pnap_2136
   00630 Glyoxylate and dicarboxylate metabolism
    Pnap_2136
   00640 Propanoate metabolism
    Pnap_2136
   00650 Butanoate metabolism
    Pnap_2136
  Lipid metabolism
   00071 Fatty acid degradation
    Pnap_2136
   00072 Synthesis and degradation of ketone bodies
    Pnap_2136
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Pnap_2136
   00310 Lysine degradation
    Pnap_2136
   00380 Tryptophan metabolism
    Pnap_2136
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Pnap_2136
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Pnap_2136
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Pnap_2136
Enzymes [BR:pna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Pnap_2136
Exosome [BR:pna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Pnap_2136
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABM37445
UniProt: A1VP67
Position
2276503..2277708
Genome map
AA seq 401 aa AA seqDB search
MMTQAFICDAIRTPFGRYGGALSSVRADDLGAIPIRALMARNPDVDWQMVADVIYGCANQ
AGEDNRNVARMSALLAGLPLEVPGGTVNRLCGSGLDALGTAARAIKSGEAGLMIAGGVES
MSRAPFVMPKAESAFSRSNAVYDTTIGWRFVNKLMKAQYGVDSMPETAENVATDFNISRQ
DQDRMALSSQLRAVAAQQAGHLAREIVGVSIPQKKGDAILVDQDEHPRATSMDVLAKLKP
IVRPDGTVTAGNASGVNDGACALLLADEASAARNGLTPRARIVGMATAGVAPRVMGIGPA
PATQKVLALTGLTIAQMDVIELNEAFAAQGLAVLRMLGVPDDDPRVNAWGGAIALGHPLG
ASGARLATTAVNRLHQSGGRYALCTMCIGVGQGIAVILERV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgatgacccaagcctttatctgcgacgccatccgcacccctttcggccgctacggcggc
gccctctcaagcgttcgcgccgacgacctgggcgccattcccatccgggccttgatggcg
cgcaacccggacgtggactggcagatggttgccgacgtgatctacggctgcgccaaccag
gccggcgaagacaaccgcaatgtggcgcgcatgagcgccttgctggccgggctgccgctg
gaagtgcccggtggcacggtcaaccgcctgtgcggctcgggtctggatgccttgggcacg
gcagcgcgcgccatcaagtcgggcgaagcgggcctgatgattgccggcggcgtcgagagc
atgagccgcgcgcctttcgtcatgccgaaggccgagagcgccttcagccgcagcaatgcg
gtctatgacacgacgattggctggcgtttcgtcaacaagctgatgaaggcgcagtacggc
gtcgattcgatgcccgaaaccgccgagaacgtcgccaccgatttcaacatcagccgccag
gaccaggaccggatggctctcagcagccagctcagggccgtcgcggcgcaacaggccggc
cacctggcgcgtgaaattgtcggggtgagcatcccccagaaaaagggcgatgccatcctt
gtggaccaggacgagcatccgcgcgccacctcgatggacgtgctggcaaaactcaagccc
atcgtgcgcccggacggcaccgtgacggcgggcaacgccagcggcgtgaacgacggcgcc
tgcgcgctgctgctggccgatgaagccagcgccgccaggaacggcctgacgcccagagcc
cgcatcgtcggcatggcgacggccggcgtggcgccgcgtgtcatgggcatcggcccggcg
ccggcgacgcaaaaggtgctggcgctgacgggtttgaccatcgcccagatggacgtgatc
gaactcaacgaagcgtttgccgcgcagggcctggccgttctgcgcatgctcggcgtgccg
gacgacgacccgcgcgtcaacgcctggggcggcgcgattgcgctgggccatccgctgggc
gccagcggcgcgcgcctggccaccacggcggtcaaccggctgcaccagagcggcgggcgc
tacgcgctgtgcaccatgtgcattggcgtggggcaaggcattgccgtgatcctggaacgg
gtttga

DBGET integrated database retrieval system