KEGG   Polaromonas naphthalenivorans: Pnap_2299Help
Entry
Pnap_2299         CDS       T00459                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna00010  Glycolysis / Gluconeogenesis
pna00071  Fatty acid degradation
pna00350  Tyrosine metabolism
pna00625  Chloroalkane and chloroalkene degradation
pna00626  Naphthalene degradation
pna01100  Metabolic pathways
pna01110  Biosynthesis of secondary metabolites
pna01120  Microbial metabolism in diverse environments
pna01130  Biosynthesis of antibiotics
pna01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pna00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pnap_2299
  Lipid metabolism
   00071 Fatty acid degradation
    Pnap_2299
  Amino acid metabolism
   00350 Tyrosine metabolism
    Pnap_2299
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Pnap_2299
   00626 Naphthalene degradation
    Pnap_2299
Enzymes [BR:pna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Pnap_2299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: ABM37607
UniProt: A1VPM9
Position
2438358..2439362
Genome map
AA seq 334 aa AA seqDB search
MLPTSMFAMSTDPLGRELLGGFKPVPQPGDHDVVLRVLACGVCRTDLHIIDGELPPRLAS
VVPGHEVVGQIVARGALASRFAVGQRVGIPWLGGTCGACAFCAMQRENLCDFPVFTGYDR
DGGFAEYAAADERFCFALPFRYDDCHAAPLLCAGLIGFRAWRLAGESAPRRLGLYGFGAA
AHIICQIAVSQKQEVYAFTQPGDAAGQQFARSLGAAWAGGSDQAPPLLLDAALIFAPVGA
LVPAALAATRKGGTVVCAGIHMSPIPTFEYRLLWGERVLKSVANLTREDGDAFFSLLEDC
RVQTHVQAFALQDANAAVQALRDGTLNGAAVLVP
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgttgccaacctccatgtttgcgatgagtaccgaccctttgggccgcgagttgctgggc
gggttcaagcctgtgccgcagcccggcgaccacgacgtggtgctgcgggtgctggcctgc
ggcgtgtgccgcaccgacctgcacatcatcgacggcgagctgccgccgcgcctggccagc
gtggtgccggggcacgaggtggtcgggcagatcgtggcccggggcgcgctggccagccgt
tttgccgtcggccagcgggtcggcattccctggctgggcggcacctgcggcgcttgtgcc
ttctgcgcgatgcagcgcgaaaacctttgcgatttcccggtgttcacgggttatgaccga
gacggcggatttgccgaatacgccgccgccgatgaacgcttttgcttcgccctgcccttt
cgctatgacgactgccacgcggcgccgctgctgtgcgccggcctcatcggctttcgcgcc
tggcgcctggccggcgaatccgcgccgcgccgcctgggcctgtacgggttcggcgccgca
gcgcacattatttgccagatcgccgtcagccagaagcaggaggtgtatgccttcacccag
ccaggcgatgcggccgggcagcagtttgcccgcagcctgggcgcggcctgggccggcggc
tcggaccaggcgccacccctgctgctcgatgccgcgctgattttcgcgccggtgggcgcc
ctggttccggcggccctggcggccacccgcaagggcggcacggtggtctgcgcaggcatc
cacatgagccccatcccgacctttgaataccggctgctctggggcgagcgtgtcctgaag
tcggtcgccaacctcacgcgcgaggatggcgatgcgtttttcagcctgcttgaggactgc
cgggtgcaaacccatgtgcaggcctttgcgctgcaggacgccaacgcagccgttcaggcc
ttgcgcgacggcacgctcaacggggcggcggtgctggttccctga

DBGET integrated database retrieval system