KEGG   Polaromonas naphthalenivorans: Pnap_2635Help
Entry
Pnap_2635         CDS       T00459                                 

Definition
putative agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
pna  Polaromonas naphthalenivorans
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pna00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2776062..2777009
Genome map
AA seq 315 aa AA seqDB search
MTTFNQPLGGNAMPRFGGWASMMRLPMCSDAAGLNAAFIGVPLDIGTSNRPGARFGPRQI
RAESSLIRPYNMATGAAPFDALQVADLGDVPINTYNLHKSVEIIEQHYQPVIDSGCIPLT
LGGDHTIVLPILRALCRRHGPVALVHVDAHADVNDDMFGERIAHGTPFRRAVEEGLLQGS
KVWQIGLRGTGYGMDDFDWPRQQGFTVVQAHEVWYQSLAPLMARVRESIGQAPCYLSFDI
DGIDPAFAGGTGTPEIGGLTVPQALEIIRGCRGLRLVGADLVEVSPPYDASGNTALLGAN
LLYEMLCVLPGVHYR
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccttcaaccaacccctgggcggcaacgccatgccccgcttcggcggctgggcc
agcatgatgcgcctgccgatgtgcagcgacgccgccggcctgaatgccgccttcatcggc
gtgccgctggacatcggcaccagcaaccggcccggcgcacgcttcggcccgcgccagatc
cgcgccgagtccagcctgatccgcccctacaacatggccaccggcgccgcgcctttcgat
gccctgcaagtggccgacctgggcgacgtgcccatcaacacctacaacctgcacaagtcg
gtcgagatcatcgagcagcattaccagcctgtcatcgacagcggctgcattccgctgacg
ctgggcggcgaccacaccatcgtgctgcccatcctgcgcgccctctgccgccggcacggg
ccggtggcgctggtgcatgtcgatgcccatgccgatgtgaatgacgacatgttcggcgag
cgcatcgcccacggcacgccgtttcggcgcgccgtcgaagaaggcctgctgcagggcagc
aaggtctggcagatcggcctgcgcggcaccggctatggcatggatgatttcgactggccg
cgccagcagggtttcaccgtggtgcaggcacatgaggtctggtaccagtcgctggcgccg
ctgatggcccgtgtgcgcgaatccatcggccaggcgccgtgctacctgagctttgacatc
gacggcatcgacccggcctttgcgggcggcaccggaacgcctgaaatcggcggcttgacg
gttccgcaggcgctggaaatcattcgcggctgccggggtttgaggctggtcggcgccgac
ctggtcgaggtgtccccgccctacgatgcttccggcaacaccgccctgctgggcgccaac
ctgctgtatgaaatgctgtgtgtattgcccggcgtgcactaccgctaa

DBGET integrated database retrieval system