KEGG   Polaromonas naphthalenivorans: Pnap_2873Help
Entry
Pnap_2873         CDS       T00459                                 

Definition
malonyl-CoA decarboxylase (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
pna  Polaromonas naphthalenivorans
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pna00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Pnap_2873
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Pnap_2873
Enzymes [BR:pna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     Pnap_2873
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3015771..3017258)
Genome map
AA seq 495 aa AA seqDB search
MNSSNWIGRNVSRLLPAASSKQKDADAQDIRAQAASKSGAEDAPKDSPAARSIPVRLEAT
LRQEGEALSPRLLRRALQELQAIIDPRVSEVEGGRRAMDVAAWYADAPLAQRRDLWLLMS
EIFVADAQKTREAQAKFAAAVGTPDEAVAEVHYRRATVSPRRRLLQRFSVYPEGVRFLVD
LRAEMLPFLKADKRLMALDVELEYMFSTWFDVGFLDLRRISWDSPASLIEKLIQYEAVHD
IKSWADVKNRLDSDRRCYGFFHPRLPGIPLIFVEVALVGEMAASIEPLLDEHAAASDLDK
ATTAIFYSISNTQPGLRGVSFGDSLIKRVVETLKDEFPRLKVFATLSPIPGLRSWLGKNA
AGLLDQLADKERTALSQAIGADPLTPGGFLDAIESPLELPEKSPLRRMLLQCAAHYLGQG
LKDGKPLDAVARFHLGNGARVERLNWAADPSPKGLKQSYGLMVNYLYDLKRLDKHRALLA
QGKVPVSTLIQDLYI
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcagcaactggatagggcgcaacgtctcccggctgctgcctgccgcctcttca
aagcaaaaagacgctgatgcgcaggacatacgggcgcaggcagctagcaaatcaggagca
gaagacgctccaaaagacagcccggccgcccgctccattcccgtgcgcctcgaagccacg
ctgcgccaggagggcgaggcgctgtcgccccgtctgctgcgccgcgccttgcaggagctg
caggccatcatcgacccgcgcgtgagcgaggtcgagggtgggcggcgagccatggacgtg
gccgcctggtatgcggacgccccgctggcgcagcgccgcgacctgtggctgctgatgagc
gaaatttttgtcgccgatgcgcaaaaaaccagggaggcccaggcgaagttcgccgcagcg
gtcggcacgcccgacgaggccgtggccgaggtgcattaccgccgcgccaccgtgtcgccg
cgccgccgcctgctccagcgtttcagcgtgtaccccgaaggcgttcgcttcctggtcgat
ctgcgggcggaaatgctgcctttcctgaaggccgacaaacggctgatggcgctcgatgtc
gagctggaatacatgttctcgacctggttcgacgtgggttttctggatttgcgccgcatc
agttgggattcgccagcgtcattgattgaaaagctgatccagtacgaagcggtgcatgac
atcaagagctgggccgatgtgaagaaccggctggacagcgaccggcgctgctacgggttt
ttccatccgcgcctgccgggcattcccctgatctttgtcgaggtcgcgctggtcggcgag
atggccgcaagcatcgagccgctgctcgacgagcatgccgccgcgtccgacctggacaag
gcgaccaccgccattttttattcgatcagcaacacccagcccggcttgcgcggcgtgagt
tttggcgactcgctgatcaagcgcgtggtggaaacgctcaaggacgagtttcccaggctc
aaggtgtttgccacgctgtcgccgattccgggcttgcggagctggcttggcaagaatgcc
gctggcctgctcgaccagctggccgacaaggagcgcacggcgctgagccaggccatcggt
gccgatccgctcacgcccggcggtttcctggatgccattgaaagtccgctggagttgccc
gagaagtcgccgctgcgccggatgctgctgcagtgcgccgcgcattacctcgggcagggg
ctgaaggatggcaagccgctcgatgcggtggcgcgctttcacctgggcaacggcgcccgc
gtggagcgcctcaactgggccgccgacccgtctcccaagggactcaaacagtcttacggc
ctgatggtcaattacctgtacgacctcaagcgcctggacaagcaccgcgcgctgctcgcg
caggggaaagtcccggtatccaccctgatccaggatttgtacatttga

DBGET integrated database retrieval system