KEGG   Polaromonas naphthalenivorans: Pnap_2880Help
Entry
Pnap_2880         CDS       T00459                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna00010  Glycolysis / Gluconeogenesis
pna00620  Pyruvate metabolism
pna00640  Propanoate metabolism
pna00680  Methane metabolism
pna01100  Metabolic pathways
pna01110  Biosynthesis of secondary metabolites
pna01120  Microbial metabolism in diverse environments
pna01130  Biosynthesis of antibiotics
pna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pna00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pnap_2880
   00620 Pyruvate metabolism
    Pnap_2880
   00640 Propanoate metabolism
    Pnap_2880
  Energy metabolism
   00680 Methane metabolism
    Pnap_2880
Enzymes [BR:pna01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Pnap_2880
Lipid biosynthesis proteins [BR:pna01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Pnap_2880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N DUF1967 CLU
Motif
Other DBs
NCBI-ProteinID: ABM38179
UniProt: A1VRA1
Position
complement(3025862..3027856)
Genome map
AA seq 664 aa AA seqDB search
MSTPDNSIQSTLVENRVFPPSEATVKAARISGMEGYNALCAEAENDFEGFWARLARENLS
WNKPFTQVLDESDAPFYKWFADGELNASYNCLDRHLGTPTESKNAIIFESDDGKVTNVTY
KELHAKVSQFASALKEMGVQKGDRVVIYMPMTIEGIVAMQACARIGATHSVVFGGFSAKS
LQERIQDAGAVAVITANYQLRGGKELPLKAIVDEGIAMGGCESIKNVIVYQRTPTACKMV
EGRDSLMHEVTAKANPVCEPEFVGAEHPLFVLYTSGSTGKPKGVQHSTGGYLLWAKLTMD
WTFDLQPNDVFWCTADIGWITGHTYITYGPLAAGATQVVFEGIPTYPNAGRFWQMIEKHK
VSIFYTAPTAIRSLIKAADADAAVHPDRSDLSSLRILGSVGEPINPEAWMWYYKNIGGER
CPVVDTFWQTETGGHMITPLPGATPLVPGSCTLPLPGIMAAIVDETGNDVPNGSGGMLVV
KRPWPSMIRTIWNDPERFKKSYFPEEMGGKIYLAGDGAVRNIDNGYFRITGRIDDVLNVS
GHRMGTMEIESALVAHPMVAEAAVVGRPDDLTGEAIVAFVVLKRSRPTGDEGKAIAKELR
DWVGKEIGPIAKPKDIRFGDNLPKTRSGKIMRRLLRGVAKGEAVTQDTSTLENPAILEQL
AQNL
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgagcacccctgacaattccatccagtccacattggttgaaaaccgcgtgttcccgccc
agcgaagccaccgtgaaggccgcgcgcatctccggcatggaaggctacaacgccctgtgc
gctgaagccgagaatgacttcgagggtttctgggcgcggctggcgcgtgaaaacctgagc
tggaacaagcccttcacccaggtgctggacgagtccgacgccccgttctacaagtggttt
gccgatggcgaactcaatgcctcctacaactgcctggaccgccacctgggcacgccgacg
gaaagcaagaacgccatcattttcgagagcgacgacggcaaggtcaccaacgtcacctac
aaggaactgcacgccaaggtcagccagttcgccagcgcgctgaaggaaatgggcgtgcaa
aagggcgaccgcgtcgtcatctacatgccgatgacgattgaaggcatcgttgccatgcag
gcctgcgcccgcatcggcgcgacgcattcggtggtgttcggcggcttctcggccaagagc
ctgcaggaacgcatccaggacgccggcgccgtggccgtcatcaccgccaactatcagttg
cgcggcggcaaggaactgccgctcaaggccatcgtcgatgaaggcatcgcgatgggcggc
tgcgagtcgatcaagaacgtgatcgtctatcagcgcaccccgaccgcctgcaagatggtc
gaaggccgcgacagcctgatgcatgaagtcaccgccaaggccaacccggtgtgcgagccc
gaattcgtcggcgccgagcatccgctgttcgtgctctacacctccggctccaccggcaag
cccaagggcgtgcagcacagcactggcggctacctgctgtgggccaagctgacgatggac
tggaccttcgacctgcagcccaacgatgtgttctggtgcaccgccgacatcggctggatc
accggccacacctacatcacctacggcccgctggccgccggcgcaacgcaggtggtcttc
gaaggcattccgacctacccgaacgccggccgcttctggcagatgatcgaaaagcacaag
gtctcgattttctacaccgcgccgaccgccatccgctcgctgatcaaggccgccgatgcc
gatgccgccgtgcatccggaccgctccgacctgagcagcctgcgcatcctcggctcggtc
ggcgagccgatcaaccccgaagcctggatgtggtactacaagaacatcggcggcgagcgc
tgcccggtggtcgataccttctggcagaccgaaaccggcggccacatgatcacgccgctg
ccaggcgccacgccgctggttcccggcagctgcacgctgccgctgcccggcatcatggca
gccatcgtcgatgaaaccggcaatgacgtgcccaacggttcgggcggaatgctggtcgtc
aagcgcccttggccgtcgatgatccgcaccatctggaacgaccccgagcgtttcaagaag
agctacttccccgaggaaatgggcggcaagatttacctcgccggcgacggcgcggtgcgc
aacatcgacaacggctacttccgcatcaccggccgcatcgacgacgtgctgaacgtctcc
ggccaccgcatgggcacgatggaaatcgagtcggcgctggtggcgcacccgatggtggcc
gaagccgccgtggtcggccgtcccgacgacctgaccggcgaggccatcgtggccttcgtg
gtgctcaagcgttcacgccccaccggcgacgaaggcaaggcgattgccaaggaattgcgc
gactgggtgggcaaggaaatcggccccatcgccaaacccaaggacatccgctttggcgac
aacctgcccaagacgcgcagcggcaagatcatgcgccgtctgctgcgcggcgtggccaag
ggcgaagcggtgacgcaagacacctcgacgcttgagaatccggccatcctggagcaactg
gcgcagaacctgtaa

DBGET integrated database retrieval system