KEGG   Polaromonas naphthalenivorans: Pnap_2990Help
Entry
Pnap_2990         CDS       T00459                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pna  Polaromonas naphthalenivorans
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pna00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3157012..3157515)
Genome map
AA seq 167 aa AA seqDB search
MRDTVTAYVALGANLGDAAAALQRAVKALDQLPLTRVSRASSLYKTAPLDTDSASESPAP
GDDYLNAVVALHTGLTAPALLDALQALELQAGRERLYRNAPRTLDLDLLLYGSARIESAR
LTVPHPRMTQRAFVLVPLAEIAQGRVTAEALEAVKHQAIERLGDSGI
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgatacggtgaccgcttatgtcgcgctgggcgccaacctgggcgatgccgcggca
gcgctgcagcgggccgtcaaggcgctggaccagttgccgctgactcgcgtcagccgggcg
tcaagcctttacaaaactgcgccgctcgataccgattcagccagcgaatcgcctgcgccg
ggcgatgattatttgaatgcggtcgtggcgctgcacaccggcctgacggcgcccgcgctg
ctcgatgccttgcaggcgctggaattgcaggccgggcgtgaaaggctttaccgcaatgcg
ccgcgcaccctcgacctggatctgctgctgtatggcagcgcgcgcattgaatccgcccgg
ctgaccgtgccgcatccgcgcatgacgcagcgggccttcgtgctggtgccgctggccgag
attgcgcagggcagggtgaccgccgaagcgcttgaggcggtgaagcaccaggccatcgag
cggctgggcgattcagggatttag

DBGET integrated database retrieval system