KEGG   Polaromonas naphthalenivorans: Pnap_3046Help
Entry
Pnap_3046         CDS       T00459                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pna  Polaromonas naphthalenivorans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pna00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pnap_3046
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pnap_3046
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pnap_3046
Enzymes [BR:pna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pnap_3046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3218969..3220273
Genome map
AA seq 434 aa AA seqDB search
MYDYHQPDLAGHFGIYGGSFVSETLTHAINELKDAYARYQNDPKFLAEFNYELKHFVGRP
SPIYHAARMSREQGGAQIYLKREDLNHTGAHKINNTIGQAMLARRMGKQRIIAETGAGQH
GVATATICARYGLECVVYMGSEDVKRQSPNVYRMNLLGATVVPVESGSKTLKDALNEAMR
DWVANVDNTFYIIGTVAGPHPYPMMVRDFQSVIGTECLSQMPEMNAGRQPDAVVACVGGG
SNAMGIFHPYIAHENTRLIGVEAAGEGLDSGKHSASLQRGLPGVLHGNRTYVLQNDDGQV
TETHSISAGLDYPGVGPEHAYLKDIGRAEYVGITDTEALQAFHYLCRTEGIIPALESAHA
VAYAMKLAKTMRSDQSILVNLSGRGDKDIGTVADLSGADFYDRPSMRGLGVKGGVATSPE
SFDASGAKGAGSQS
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgtacgactatcaccaacctgacctggccggtcatttcggcatttacggcggcagtttc
gtctccgaaaccctgacccacgcgatcaatgagctgaaggacgcctacgccaggtaccag
aacgacccgaaattcctggccgaattcaactacgagctgaagcatttcgtcggccgccct
tcccccatctaccatgccgcgcgcatgagccgcgaacagggcggcgcgcagatctacctc
aagcgcgaagacctgaaccacaccggcgcgcacaagatcaacaacaccatcggccaggcc
atgctggcccgccgcatgggcaagcagcgcatcattgcagagaccggcgcgggccagcac
ggcgtggccaccgccacgatttgcgcccgctacggccttgaatgcgtggtctacatgggc
agcgaggatgtcaagcgccagagccccaatgtttaccgcatgaacctgctgggcgccacc
gtggtgccagtggaaagcggcagcaagacgctgaaagatgcgctcaacgaagccatgcgc
gactgggttgccaatgttgacaacacgttttacatcatcggaaccgtggccggaccgcac
ccctacccgatgatggtgcgcgacttccagagcgtgatcggcaccgaatgcctgagccag
atgcccgagatgaacgctggcaggcagcccgatgcggtcgttgcctgtgttggcggcggc
agcaatgccatgggcatcttccacccttatatcgcgcatgaaaacacccgcctgatcggc
gtcgaagccgccggagaagggctggacagcggcaagcattcagcttcgctgcagcgcggc
ctgcccggcgtgctgcatggcaaccgcacctatgtgctgcaaaacgacgatggccaggtg
accgagacgcacagcatcagcgccggactggactaccccggcgtcggcccggagcacgcc
tacctgaaagacatcgggcgcgccgaatatgtcggcatcaccgacaccgaagcgctgcag
gcttttcattacctgtgccgcaccgaaggcatcattccggcactggaatccgcccatgcc
gtggcctacgcgatgaagctggccaaaaccatgcgcagcgaccagagcatcctcgtcaac
ctctcgggccggggcgacaaggacattggcaccgtggccgatctgtcgggtgctgacttc
tatgaccggccttccatgcgcggcctgggcgtcaagggtggcgttgccacttcccccgaa
tcattcgacgccagcggcgcaaaaggtgcagggagccagtcatga

DBGET integrated database retrieval system