KEGG   Polaromonas naphthalenivorans: Pnap_3047Help
Entry
Pnap_3047         CDS       T00459                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pna  Polaromonas naphthalenivorans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pna00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pnap_3047 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pnap_3047 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pnap_3047 (trpA)
Enzymes [BR:pna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pnap_3047 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3220270..3221088
Genome map
AA seq 272 aa AA seqDB search
MSRIESTFSSLKTQGRKALIPYVTAGFPFADVTPELMHGMVAGGADVIELGMPFSDPSAD
GPVIQKAGEKALSFGIGLVQVLEMVRIFRTKDHTTPVVLMGYANPVERYDIKHGAGASES
AFIRDAAAAGVDGMLIVDYPPEECVEFSARLKAHGMDLIFLLAPTSTDARMAQVAQVASG
YVYYVSLKGVTGAGTLDVDAVEAMLPRIRRHVNVPVGVGFGIRDAATAKAIGKVADAVVI
GSKIIQLIENQPRDRVAAVAHDFLKEIRSALD
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcattgaatcgactttctccagccttaaaacccagggtcgcaaggccttgatc
ccctacgtcacggcgggctttccgtttgccgatgtcacgcccgaactgatgcacggcatg
gtggccggcggcgctgacgtgattgaactgggcatgccgttttccgaccccagcgccgat
ggcccggtgatccagaaggccggagaaaaagcgctttccttcggcatcggcctggttcag
gtgcttgaaatggtgcgcattttccgcacaaaagaccacacgacgccagtcgtgctcatg
ggctacgccaacccagtcgagcgctacgacatcaagcatggcgcaggcgcctccgaaagc
gcctttatccgcgatgccgccgccgccggtgtcgatggcatgctgatcgttgactatccg
ccagaagagtgcgtggaattttccgccagactcaaggcgcacggcatggacctgatcttt
ttgctggcacccaccagcaccgacgcacgcatggcccaggtcgcccaggtcgccagcggc
tatgtgtattacgtgtcgctcaagggcgtgaccggcgccggcacgctggacgtggatgcg
gtcgaagccatgctgccgcgcattcgccggcatgtgaacgtgcctgtcggcgtgggcttt
ggcattcgcgacgccgcgaccgcaaaggccataggcaaagtggctgatgccgtggtcatt
ggcagcaagatcatccagctgattgaaaaccagccgcgcgaccgggttgccgccgtggcg
catgactttttgaaggaaatccgctcggcgctggactga

DBGET integrated database retrieval system