KEGG   Polaromonas naphthalenivorans: Pnap_3047Help
Entry
Pnap_3047         CDS       T00459                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna00260  Glycine, serine and threonine metabolism
pna00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pna01100  Metabolic pathways
pna01110  Biosynthesis of secondary metabolites
pna01130  Biosynthesis of antibiotics
pna01230  Biosynthesis of amino acids
Module
pna_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pna00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pnap_3047
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pnap_3047
Enzymes [BR:pna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pnap_3047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB
Motif
Other DBs
NCBI-ProteinID: ABM38346
UniProt: A1VRR8
Position
3220270..3221088
Genome map
AA seq 272 aa AA seqDB search
MSRIESTFSSLKTQGRKALIPYVTAGFPFADVTPELMHGMVAGGADVIELGMPFSDPSAD
GPVIQKAGEKALSFGIGLVQVLEMVRIFRTKDHTTPVVLMGYANPVERYDIKHGAGASES
AFIRDAAAAGVDGMLIVDYPPEECVEFSARLKAHGMDLIFLLAPTSTDARMAQVAQVASG
YVYYVSLKGVTGAGTLDVDAVEAMLPRIRRHVNVPVGVGFGIRDAATAKAIGKVADAVVI
GSKIIQLIENQPRDRVAAVAHDFLKEIRSALD
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcattgaatcgactttctccagccttaaaacccagggtcgcaaggccttgatc
ccctacgtcacggcgggctttccgtttgccgatgtcacgcccgaactgatgcacggcatg
gtggccggcggcgctgacgtgattgaactgggcatgccgttttccgaccccagcgccgat
ggcccggtgatccagaaggccggagaaaaagcgctttccttcggcatcggcctggttcag
gtgcttgaaatggtgcgcattttccgcacaaaagaccacacgacgccagtcgtgctcatg
ggctacgccaacccagtcgagcgctacgacatcaagcatggcgcaggcgcctccgaaagc
gcctttatccgcgatgccgccgccgccggtgtcgatggcatgctgatcgttgactatccg
ccagaagagtgcgtggaattttccgccagactcaaggcgcacggcatggacctgatcttt
ttgctggcacccaccagcaccgacgcacgcatggcccaggtcgcccaggtcgccagcggc
tatgtgtattacgtgtcgctcaagggcgtgaccggcgccggcacgctggacgtggatgcg
gtcgaagccatgctgccgcgcattcgccggcatgtgaacgtgcctgtcggcgtgggcttt
ggcattcgcgacgccgcgaccgcaaaggccataggcaaagtggctgatgccgtggtcatt
ggcagcaagatcatccagctgattgaaaaccagccgcgcgaccgggttgccgccgtggcg
catgactttttgaaggaaatccgctcggcgctggactga

DBGET integrated database retrieval system