KEGG   Polaromonas naphthalenivorans: Pnap_3089Help
Entry
Pnap_3089         CDS       T00459                                 

Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna00860  Porphyrin and chlorophyll metabolism
pna01100  Metabolic pathways
pna01110  Biosynthesis of secondary metabolites
pna01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pna00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Pnap_3089
Enzymes [BR:pna01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Pnap_3089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Ribosomal_S11
Motif
Other DBs
NCBI-ProteinID: ABM38388
UniProt: A1VRW0
Position
complement(3263051..3263914)
Genome map
AA seq 287 aa AA seqDB search
MTTARVIVTRPAPDAALWVRQLEQAGIAAEAFELIDIAPVGSAADAQALGDAWLALDAYA
ACLFVSGHAVEHFFKENKAFAQGGYAQAAINNIANSGLRRIPPGLRFMAPGPGTVAALRA
AGVPAAQIDAPAADASQFDSEALWRVVGARDWQGRKVLIVRGQSAGAQGATSGRDWIVRQ
WQGAGASVDFVGVYQRRAPILTDAQVARARQASADGSVWLFSSSEAVANLVGQAGLQGVD
WGRARAVATHPRIAQAVRAAGWGVVVESRPALKDIRQALGSIESHYP
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaccgcccgcgtgatcgtgacccggcccgcgcccgacgccgcgctgtgggttcgg
caactggagcaggccggcatcgccgccgaggcgttcgagctgatcgacatcgcgcccgtt
ggcagcgctgccgatgcgcaggcgctcggggacgcctggctggcgctggacgcttacgcc
gcctgcctgttcgtcagcggccatgcggtggagcacttttttaaggaaaataaggctttt
gcgcaaggtggatatgcgcaggcagctattaataacatagcaaacagtgggctgcgccga
atcccgccaggcctgcgtttcatggcgcccggccccggcacggtggccgcgctgcgggcg
gccggcgttcctgccgcgcagattgatgcgccggcggccgacgccagccagttcgactcc
gaagcgctgtggcgggtcgttggcgcgcgtgactggcagggccgcaaggtgctgatcgtg
cgcggccaaagcgccggcgcccaaggcgccacctccgggcgcgactggattgttcgccag
tggcaaggcgctggcgccagcgtcgattttgtcggcgtttaccagcgccgcgcgcccatc
ctgaccgacgcgcaggtcgctcgcgcgcgccaagccagtgccgacggctcggtctggctg
ttcagcagttccgaagccgtggccaacctggtcgggcaggcggggctgcaaggcgtcgat
tggggccgcgcccgcgccgtggccacccatccccggattgcccaggccgtgcgggccgcc
ggctggggtgttgttgtggagtcacgcccggcgctcaaggacatccggcaggcgcttggc
tcgatagaatcgcactatccatga

DBGET integrated database retrieval system