KEGG   Polaromonas naphthalenivorans: Pnap_3175Help
Entry
Pnap_3175         CDS       T00459                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna00040  Pentose and glucuronate interconversions
pna00052  Galactose metabolism
pna00500  Starch and sucrose metabolism
pna00520  Amino sugar and nucleotide sugar metabolism
pna01100  Metabolic pathways
pna01130  Biosynthesis of antibiotics
Module
pna_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pna00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Pnap_3175
   00052 Galactose metabolism
    Pnap_3175
   00500 Starch and sucrose metabolism
    Pnap_3175
   00520 Amino sugar and nucleotide sugar metabolism
    Pnap_3175
Enzymes [BR:pna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Pnap_3175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: ABM38473
UniProt: A1VS45
Position
complement(3372644..3373549)
Genome map
AA seq 301 aa AA seqDB search
MNIQKVTKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEEAAAAGITEMIFVTS
QSKRSIEDHFDRSWELESLLIKRQKNEMLELVQKIKPAHVNCIYVRQAEALGLGHAVLCA
ESVVGNAPFAVLLADDLLDATTPVLRQMLQIYEQYQASVVAVERIQPAQTRSYGVVAGDA
ARQCKQGQAFAISGIVEKPSPEEAPSDLGVVGRYVLDARIFDKLRNLNPGSGGEIQLTDG
IEALLKENAVMAYLYEGVRYDCGSKLGYLKASVDFALRHPELDTEFAAFLQQRAASIQTA
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcaaaaagtcaccaaagctgtatttccggtcgccggcctcggcacccgtttc
ttgccggccaccaaggccagccccaaggaaatgctgcccatcgtggacaagccgctgatt
cagtatgcggtggaagaggccgctgcggccggcatcacagagatgatttttgtcaccagc
cagagcaagcgctcgattgaagaccactttgaccgttcctgggagctggagagtctgctg
atcaagcgccagaaaaacgaaatgctggagctggtacagaaaatcaaacccgcgcacgtc
aactgcatctatgtgcgccaggctgaagcgcttggtctgggccatgcggtgctgtgcgcc
gaaagcgtggtgggcaacgcgccttttgccgtgctgctggccgatgacttgctggatgcg
acgacgccggtgctgcgccagatgctccagatttacgaacagtatcaagccagcgtggtg
gcggtggaacgcattcagcctgcgcaaacccgctcctacggcgtggtggccggtgacgca
gcgcgccagtgcaagcaggggcaggcttttgccatcagcggcatcgtcgaaaaaccgtct
ccggaagaagcgccttctgacctgggtgtggtcgggcgctatgtgctggacgcacgcatt
tttgacaaactgcgcaatctgaatcccggttcaggcggcgagattcagctcactgacggc
atcgaggcattgctgaaggaaaacgccgtgatggcctacctgtatgaaggcgtgcgctac
gactgcggcagcaagctgggctacctgaaagcctcggtggactttgccttgcgccacccc
gagctggatactgagtttgctgcctttttgcagcaacgcgccgcgagcatccagactgcg
gcttga

DBGET integrated database retrieval system