KEGG   Polaromonas naphthalenivorans: Pnap_3367Help
Entry
Pnap_3367         CDS       T00459                                 

Definition
putative thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
pna  Polaromonas naphthalenivorans
Brite
Enzymes [BR:pna01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Pnap_3367
Secretion system [BR:pna02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Pnap_3367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3567211..3567948
Genome map
AA seq 245 aa AA seqDB search
MKLIKLTAGLKQAGLAGLLACSLGSAFAQEAVIRKNLAERLPALAKIDEVSKTPMNGLYE
IRVNDSDIFYTDAEGNFLLQGNLIDTRAKRNLTEERVEKLSAIDFAALPLKDAFTQVRGN
GKRKLAVFEDPNCGYCKRFERDLQKVNDVTIHTFLIPILSADSVEKSKNIWCAKDKNKAW
LDWMVRDQAAAKASCDTAALERNLAFSKKYKITGTPTLFFADGSRVPGAIGAEQIEKTLA
SAKAP
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaatcaaattgaccgccggcttgaagcaggctggactcgccggcctgctggcc
tgcagcctgggttctgcttttgcgcaggaggcggtcattcgcaagaacctggccgaacgg
ctgccggcgcttgccaagatcgacgaagtcagcaagacgccgatgaacgggctgtatgaa
atccgcgtcaacgacagcgacattttctacaccgatgccgagggcaacttcctgctgcag
ggcaacctgatcgacacccgggccaagcgcaacctgaccgaggagcgcgtcgagaaactc
agcgccatcgactttgccgcgctgccgctcaaggacgccttcacccaggtgcgcggcaac
ggcaaacgcaagctggcggtgtttgaagacccgaactgcggttattgcaaacgcttcgag
cgcgacctgcaaaaggtcaacgacgtgacgatccacacctttttgattcccatcctgagc
gccgactcggtggaaaagtcgaaaaacatctggtgcgccaaggacaagaacaaagcctgg
ctcgactggatggtgcgcgaccaggccgccgccaaggccagctgcgacacggccgcgctg
gagcgcaacctggccttcagcaaaaagtacaagatcaccggcacgccgaccctgttcttt
gccgacggctcacgggtgcctggcgccatcggtgccgagcagatcgaaaaaacgctggcc
agcgccaaggcgccgtaa

DBGET integrated database retrieval system