KEGG   Polaromonas naphthalenivorans: Pnap_3407Help
Entry
Pnap_3407         CDS       T00459                                 

Definition
(GenBank) shikimate dehydrogenase
  KO
K00014  shikimate dehydrogenase [EC:1.1.1.25]
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pna01100  Metabolic pathways
pna01110  Biosynthesis of secondary metabolites
pna01130  Biosynthesis of antibiotics
pna01230  Biosynthesis of amino acids
Module
pna_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:pna00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pnap_3407
Enzymes [BR:pna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.25  shikimate dehydrogenase
     Pnap_3407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Shikimate_dh_N Shikimate_DH Sacchrp_dh_NADP F420_oxidored ThiF
Motif
Other DBs
NCBI-ProteinID: ABM38704
UniProt: A1VSS6
Position
3613839..3614699
Genome map
AA seq 286 aa AA seqDB search
MTSDNAAIDRYFVLGNPIAHSRSPQIHARFAELAGQAIDYQRCLVPLDGFAATLAQLVQD
GVRGCNVTVPFKFEAFQAANTRSDRAQLAQAVNTLVMENSKIHADNTDGVGLVNDIQVNA
GVPLAGRDVLLIGAGGAGAGVLGPLLAAGPRRLVLVNRTLAKAEALAARHRAHASLQTVL
QKTELLVQEPHAVEGEFDVIVNASASSLAGSAVPVAGSVLKPGALAYDMMYGPAAAGFMA
WAREHGASPRDGLGMLVEQAAESFSLWRGVRPPAAQVLQELRLLLA
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcgataacgcggcaatcgaccgctattttgtgctcggcaacccgattgcccac
agccgatccccgcagatccatgcgcgttttgccgagctggccgggcaggccatcgactac
cagcgctgcctggtgccgctggacgggtttgcggccacgctggcgcaactggtccaggac
ggcgtgcgcggctgcaatgtcaccgtgccgttcaagttcgaggcgtttcaagccgcaaac
acccgcagcgaccgggcgcagttggcccaggccgtcaacacgctggtgatggaaaacagc
aagattcatgcggacaacaccgatggcgtcgggctggtcaatgacatccaggtcaacgcg
ggcgtgccgctggccgggcgcgacgtgctcttgattggcgcgggcggcgcgggcgcgggc
gtgctggggccgctgctggcggccgggccgcgccggctggtgctggtcaaccgcacactg
gccaaggccgaggcgctggcggcgcgtcacagggcgcatgcctcgctgcagacagtgcta
caaaaaacagagctactggtgcaggagccgcatgcggtagagggtgagttcgatgtgatt
gtcaatgccagcgccagcagccttgcaggcagcgccgtgccggtggccggcagcgtgctc
aagcccggcgcgctggcttacgacatgatgtacggcccagcggcggccggcttcatggcc
tgggcgcgcgagcatggcgccagcccgcgcgacggcctgggcatgctggtcgagcaggct
gccgaatcgttttcattgtggcgcggcgtgcgtccgccagcggcgcaggtgctgcaggaa
ctgcgcttgctgctggcatga

DBGET integrated database retrieval system