KEGG   Polaromonas naphthalenivorans: Pnap_3422Help
Entry
Pnap_3422         CDS       T00459                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
  KO
K01928  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna00300  Lysine biosynthesis
pna00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:pna00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Pnap_3422
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Pnap_3422
Enzymes [BR:pna01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Pnap_3422
Peptidoglycan biosynthesis and degradation proteins [BR:pna01011]
 Precursor biosynthesis
  Amino acid ligase
   Pnap_3422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase LpxK
Motif
Other DBs
NCBI-ProteinID: ABM38719
UniProt: A1VSU1
Position
complement(3629555..3631045)
Genome map
AA seq 496 aa AA seqDB search
MQLHTPEQAACWLHERVIGTLSADSRKAGQGDGFIAWPGAATDGRNYVNAALAAGASACL
VEHAGAQAYGFNDDRVATYAGLKAATGPMAAAYFGAPSEQLQVTAITGTNGKTSTAWWLA
QALGRLGRKCGIVGTLGIGEPGAMVANGLTTPDPVLLQQQLRRFADEGFAACALEASSIG
LEEGRLDGTRIQIAVFTNFTQDHLDYHASMPDYWRAKQMLFNWPGLRAAIINVDDSRGLE
LSAALAGTSLDVWTLSCAGPARLQAQAICQGAHDLSFDVVEGGERHRISTPMVGLYNVSN
LLGVMASLRAMDVPLADAVAACADLLPVPGRTETLAVPGLPLVVIDYAHTPDALEKVLTA
LNPVAQGRGGRLWCVFGCGGDRDAGKRPLMAAAAEKNADQLVITSDNPRSEDPVTIIGQM
LKGLSRPQVAHVQEDRRAAIAHALQLAQPQDVVLLAGKGHENYQEIKGVKFAFSDRDQAQ
AILDALVATRQAEEAA
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgcaacttcacacccctgagcaagccgcctgctggctgcatgagcgcgtcataggtacg
ctctcggccgacagccgcaaggcaggccagggcgacggttttatcgcctggccgggtgcg
gccaccgatggccgcaactatgtcaatgccgccctggctgccggagcaagcgcctgcctg
gtcgaacatgcgggcgcgcaggcttacggtttcaatgatgaccgggttgcaacttatgcg
ggactcaaggcggcaaccggcccaatggccgctgcttattttggagcgcccagcgagcag
ttgcaggtaacggccatcaccggcaccaatggcaagacctccacagcttggtggctggcg
caggccctcggccggctgggccgcaaatgcggcattgtcggaacgctgggcattggcgag
cccggtgccatggtggccaacgggctgaccacgcccgaccctgtgctgctgcagcagcaa
ctgcggcgttttgcggatgaaggcttcgccgcctgtgcccttgaagcctcttcgattggc
cttgaagaggggcgcctggatggaacacgcatacagattgctgttttcaccaatttcacc
caggaccatctcgactaccacgcgtccatgccggactactggcgcgccaagcagatgctg
ttcaactggcctggtctgcgcgcggccatcatcaatgtggacgatagccggggcctggag
ttgagcgctgcgctggcgggtacttcgctggacgtctggaccttgtcgtgcgccggtcct
gcaaggcttcaggctcaggccatctgccaaggcgcgcatgacttgagctttgacgtggtt
gaaggcggcgagcgccacagaatttcaacccccatggtcggcctctacaacgtgtcgaat
ttgctgggcgtcatggccagcctgcgggcaatggatgtgccgctggccgacgccgtggcg
gcctgtgccgacctgttgcccgtgcccggtcgcaccgaaaccctggcagttcccggtctg
cccttggttgtcattgattacgcgcacacgcccgatgcacttgaaaaagtgctgacggcg
ctcaacccggttgcacagggccggggcggccggctctggtgtgtttttggctgcggtggt
gaccgtgatgccggcaaacgccccttgatggcggctgcggcggaaaaaaatgcagatcag
ctggtgatcaccagcgacaacccgcgcagtgaagaccctgtgaccatcatcgggcagatg
ctcaaggggctgagccggccacaggtcgcgcatgtgcaggaagaccggcgtgcagccata
gcccatgcgctgcaactcgcccagccgcaggatgtcgtcctgctggcgggcaaaggacat
gaaaattatcaggagatcaagggagtgaagtttgcattttctgaccgggaccaggcgcaa
gccatcctggatgccctggtggcaacgcgccaagcggaggaggccgcatga

DBGET integrated database retrieval system