KEGG   Polaromonas naphthalenivorans: Pnap_3488Help
Entry
Pnap_3488         CDS       T00459                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna00521  Streptomycin biosynthesis
pna00523  Polyketide sugar unit biosynthesis
pna01130  Biosynthesis of antibiotics
Module
pna_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:pna00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Pnap_3488
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Pnap_3488
Enzymes [BR:pna01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Pnap_3488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ABM38785
UniProt: A1VT07
Position
complement(3702465..3703010)
Genome map
AA seq 181 aa AA seqDB search
MKVIPTAIADVLIIEPRVFGDARGFFYESFNQKAFNDATGTDHQFVQDNHSRSVKGVMRG
LHYQVQQPQGKLVRVARGAVFDVAVDIRKSSPTFGKWVGVELSEDNHRQLWVPPGFAHGF
VVTSESADFLYKTTDYYAPEFERCIAWNDSVIGIQWPLAPHGIAQPVLSAKDLQGKSLSE
A
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtaatacccacggcgattgccgacgttctgatcatcgagcccagggtatttggc
gatgcgcgcggtttcttttatgaaagcttcaaccagaaggcgttcaacgacgctaccggg
accgatcaccagttcgtgcaggacaaccacagtcgcagcgtcaagggcgtcatgcgcggt
ctgcattaccaggtccagcaaccgcagggtaagctggtgcgtgtggcgcgcggggctgtc
tttgatgtcgcggtggatattcgcaagagttcgccgacgttcggaaaatgggtgggcgtg
gaactgagcgaagacaaccaccggcagctgtgggtgccgccgggttttgcgcacgggttc
gtggtgaccagcgaatcggctgatttcctgtacaagacgaccgattactatgcgcctgag
tttgagcgctgcattgcgtggaatgattcagttattggtattcaatggccgctggccccg
cacggcatcgcacagcctgtactttctgccaaggatttgcagggtaaaagtttgagcgaa
gcctga

DBGET integrated database retrieval system