KEGG   Polaromonas naphthalenivorans: Pnap_3557Help
Entry
Pnap_3557         CDS       T00459                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna00010  Glycolysis / Gluconeogenesis
pna00030  Pentose phosphate pathway
pna00051  Fructose and mannose metabolism
pna00052  Galactose metabolism
pna00680  Methane metabolism
pna01100  Metabolic pathways
pna01110  Biosynthesis of secondary metabolites
pna01120  Microbial metabolism in diverse environments
pna01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pna00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pnap_3557
   00030 Pentose phosphate pathway
    Pnap_3557
   00051 Fructose and mannose metabolism
    Pnap_3557
   00052 Galactose metabolism
    Pnap_3557
  Energy metabolism
   00680 Methane metabolism
    Pnap_3557
Enzymes [BR:pna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Pnap_3557
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Pnap_3557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ABM38853
UniProt: A1VT75
Position
complement(3777739..3778959)
Genome map
AA seq 406 aa AA seqDB search
MASGKILVAQGGGPTAVINQSLVGVALEARRFGEVTRIYGARHGVRGIVNEDFVDLTQET
SHNLELVANTPSSALGSTRDKPDMRYCQEIFKVLQAHQIEHFFYIGGNDSSDTVRIVSLE
AQKAGYPLRSIHIPKTIDNDLVGNDHTPGFPSAARFVAQAFAGANLDNAALPGVYVGVVM
GRHAGFLTAASALGKKFPDDGPHLIYLPERTFVLENFLADVKAAYARFGRCVIAVSEGIH
DASGAPIASLLAKDLEHDAHGNVQLSGNGALADLLCEEIKSKLGIKRVRGDTFGYLQRSF
IGCVSDVDQREAREVGEKAVQFAMWGTQDGSVAIKRTGFYSVDYELLPLDAVAGKTRVME
DEFIASSGTDVTDAFRMYLRPLLGSGMPDAFRLRHHPVAKVLNPGR
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggcatccggaaaaatactcgtcgcccagggtggcggtccgacggcggtgatcaaccag
tcgctggtcggcgtggcgctggaggcgcggcgctttggcgaagtcacgcgcatctacggc
gcgcgccacggcgtgcgcggcatcgtcaatgaagacttcgtcgatctgacgcaggaaacc
agccacaacctcgaactggtcgccaacacgccgtcctcggcgctgggctcgacgcgcgac
aagcccgacatgcgctattgccaggaaatcttcaaggtcctgcaggcgcaccagatcgag
cacttcttctacatcggcggcaacgactcgtcggacacggtgcgcatcgtcagcctggag
gcgcaaaaagctggctacccgctgcgcagcatccacatcccgaaaaccatcgacaacgac
ctggtgggcaacgaccacacgcccggctttccgtcggccgcgcgcttcgtggcgcaggcg
tttgccggcgccaacctggacaacgcggcgctgcccggcgtgtacgtgggcgtggtgatg
ggccgccatgccggattcctgacggcggcatccgcgctgggcaagaagtttcccgacgac
ggcccgcacctgatctacctgcccgagcgcaccttcgtgctggagaattttctcgccgac
gtgaaggcggcctacgcgcgcttcgggcgctgcgtgatcgccgtgtccgaaggcatccac
gatgcgtcgggcgcgccgattgccagcctgctggccaaagacctggagcacgacgcgcac
ggcaacgtgcagctgtcgggcaacggcgcgctggccgatttgctgtgcgaggagatcaag
tccaaactcggcatcaagcgggtgcgcggggacaccttcggctacctgcagcgctccttc
atcggctgcgtgtccgacgtggaccagcgcgaagcgcgcgaggtcggggaaaaagccgtg
cagttcgcgatgtggggcacgcaggacggctcggtcgccatcaagcgcaccgggttttat
tcggtcgattacgaactgctgccgctagatgccgtggccggcaagacgcgggtgatggag
gacgagttcatcgccagcagcggcaccgacgtgaccgatgccttcaggatgtatttgcgc
ccgctgctgggctccggcatgcccgacgccttcaggctgcggcatcatccggtcgccaag
gtgctgaatcccggtcgctga

DBGET integrated database retrieval system