KEGG   Polaromonas naphthalenivorans: Pnap_3575Help
Entry
Pnap_3575         CDS       T00459                                 

Definition
CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
pna  Polaromonas naphthalenivorans
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:pna02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:pna02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3798759..3799784
Genome map
AA seq 341 aa AA seqDB search
MENSQLPNRDIVVIGASAGGVEALRGFFAALPADLDAAILVVLHIPADTPSQLDQVLANA
TPLPVVIAEDGQPIEHGRVYVASADRHLMVTPQGIRLSRGPKEVRARPSVDVLFRSAAAA
FGSRVIGVVLSGALDDGTAGLWAIKDHQGATLVQIPSQAMHPSMPESAIAHVQVDFVGTV
EALADKVRELVGTAAPVVAASALSLQRAMENDIAMQGNALKAGIMNLGKVSPYTCPDCHG
VLMQIEEGTIVRFRCHTGHAFSLKTLMAEINDAIDQSLWATLRAVEERVMLLRQMEQLAL
HSGANDTAAQWRKQADDSEQRLQPLRDLVLDPGFFGHASKN
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggaaaactcacaattgccaaaccgcgacatcgtggtcatcggggcgtcggccggcggg
gtcgaggcgttgcggggcttctttgcggccttgcccgccgacctcgatgccgccatcctg
gtggtgctgcacattccggccgacacaccgagccagctcgaccaggtgctggcgaatgcg
acgccgcttccggtcgtgattgccgaagatggccagccgattgagcacgggcgtgtttat
gtcgcctcggccgaccggcacctcatggtcacgccgcaaggcatccggctcagccggggg
ccgaaggaagtccgcgccaggccgtcggtcgatgtgctgtttcgctcggccgccgcagcg
tttggctcgcgcgtcatcggcgtggtcctgagcggcgcgctcgacgacggcacggccggg
ctctgggccatcaaggaccaccagggcgccacgctggtgcagattccttcgcaggccatg
catccctccatgcccgaaagcgccattgcgcatgtccaggtagattttgtcggcacggtc
gaagcgctggccgacaaggtcagggaactggtcggcaccgccgcgcccgtggtggcggcc
agcgctttgagcctgcagcgcgccatggaaaacgacatcgccatgcaaggcaatgcactc
aaggccggcatcatgaacctgggcaaggtttccccctacacctgccccgattgccatggc
gtgctgatgcagatcgaagaaggcacgattgttcgttttcgctgccacaccggccatgcg
ttttcactcaagaccctcatggccgagatcaacgacgccatcgaccaaagtctgtgggcg
accttgcgcgccgtcgaagagcgggtgatgctgctgcgccagatggaacagttggcgctt
cattccggcgcgaacgacacggcagcgcaatggcgcaagcaggccgatgactcggaacag
cggctccagccgctgcgcgacctggtgcttgatccgggctttttcgggcatgcgtccaag
aactga

DBGET integrated database retrieval system