KEGG   Polaromonas naphthalenivorans: Pnap_3643Help
Entry
Pnap_3643         CDS       T00459                                 

Gene name
rplA
Definition
50S ribosomal protein L1
Orthology
K02863  
large subunit ribosomal protein L1
Organism
pna  Polaromonas naphthalenivorans
Pathway
Ribosome
Module
Ribosome, bacteria
Class
Genetic Information Processing; Translation; Ribosome [PATH:pna03010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3879473..3880168)
Genome map
AA seq 231 aa AA seqDB search
MSKLTKRQKTVGDKIDSNKLYALSDALGLVKEFAVAKFDESIDVAVQLGIDAKKSDQVVR
GAVVLPNGTGKTKRVAVFAQGAKAEEAKAAGADIVGMDDLAADIKAGKMDFDVVIASPDA
MRIVGTLGQILGPRGLMPNPKVGTVTPDVATAVRNAKAGQVQFRVDKAGIVHGTIGRRSF
DTAKLQGNLAALVDALIKAKPATSKGVYLKKVAVSSTMGVGVRVDTQSIAA
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagctgaccaaacgtcaaaaaaccgtcggcgacaagatcgacagcaacaagctg
tacgcactgtctgacgcactgggccttgtcaaagagttcgctgtcgccaagttcgatgag
tccatcgacgtggccgtgcaactcggtatcgatgccaagaaatctgaccaggttgttcgc
ggcgctgtcgtgctgccaaacggcaccggtaaaaccaagcgtgtcgctgtgttcgcccaa
ggtgccaaggctgaagaagccaaggctgccggtgcagacatcgttggcatggatgatctg
gctgccgacatcaaggccggcaagatggacttcgacgtcgtgattgcttcccctgatgcg
atgcgcatcgtcggtacgctgggccagatcctcggcccacgcggtctgatgcctaacccc
aaggtcggcacggtgacgcctgacgtcgcgaccgctgtgcgcaatgcaaaagctggccag
gtccagttccgcgttgacaaggccggtattgtgcatggcaccatcggtcgccgttcgttc
gacaccgccaagctgcaaggcaatctggctgcattggttgacgcgctgatcaaggccaag
cctgctaccagcaagggcgtgtacttgaagaaagtcgctgtttcatcaacgatgggcgtg
ggcgttcgcgtcgatacgcaatccatcgcggcttga

DBGET integrated database retrieval system