KEGG   Polaromonas naphthalenivorans: Pnap_3643Help
Entry
Pnap_3643         CDS       T00459                                 

Definition
(GenBank) LSU ribosomal protein L1P
  KO
K02863  
large subunit ribosomal protein L1
Organism
pna  Polaromonas naphthalenivorans
Pathway
Ribosome
Module
Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:pna00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    Pnap_3643
Ribosome [BR:pna03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    Pnap_3643
  Bacteria
    Pnap_3643
  Archaea
    Pnap_3643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3879473..3880168)
Genome map
AA seq 231 aa AA seqDB search
MSKLTKRQKTVGDKIDSNKLYALSDALGLVKEFAVAKFDESIDVAVQLGIDAKKSDQVVR
GAVVLPNGTGKTKRVAVFAQGAKAEEAKAAGADIVGMDDLAADIKAGKMDFDVVIASPDA
MRIVGTLGQILGPRGLMPNPKVGTVTPDVATAVRNAKAGQVQFRVDKAGIVHGTIGRRSF
DTAKLQGNLAALVDALIKAKPATSKGVYLKKVAVSSTMGVGVRVDTQSIAA
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagctgaccaaacgtcaaaaaaccgtcggcgacaagatcgacagcaacaagctg
tacgcactgtctgacgcactgggccttgtcaaagagttcgctgtcgccaagttcgatgag
tccatcgacgtggccgtgcaactcggtatcgatgccaagaaatctgaccaggttgttcgc
ggcgctgtcgtgctgccaaacggcaccggtaaaaccaagcgtgtcgctgtgttcgcccaa
ggtgccaaggctgaagaagccaaggctgccggtgcagacatcgttggcatggatgatctg
gctgccgacatcaaggccggcaagatggacttcgacgtcgtgattgcttcccctgatgcg
atgcgcatcgtcggtacgctgggccagatcctcggcccacgcggtctgatgcctaacccc
aaggtcggcacggtgacgcctgacgtcgcgaccgctgtgcgcaatgcaaaagctggccag
gtccagttccgcgttgacaaggccggtattgtgcatggcaccatcggtcgccgttcgttc
gacaccgccaagctgcaaggcaatctggctgcattggttgacgcgctgatcaaggccaag
cctgctaccagcaagggcgtgtacttgaagaaagtcgctgtttcatcaacgatgggcgtg
ggcgttcgcgtcgatacgcaatccatcgcggcttga

DBGET integrated database retrieval system