KEGG   Polaromonas naphthalenivorans: Pnap_3683Help
Entry
Pnap_3683         CDS       T00459                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna00620  Pyruvate metabolism
pna00630  Glyoxylate and dicarboxylate metabolism
pna01100  Metabolic pathways
pna01110  Biosynthesis of secondary metabolites
pna01120  Microbial metabolism in diverse environments
pna01200  Carbon metabolism
Module
pna_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pna00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Pnap_3683
   00630 Glyoxylate and dicarboxylate metabolism
    Pnap_3683
Enzymes [BR:pna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Pnap_3683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ABM38979
UniProt: A1VTK1
Position
complement(3918792..3920984)
Genome map
AA seq 730 aa AA seqDB search
MTERTTRHSLQVATELYRFIEDKVLPGTGVDSDKFWSGFDAIVADLAPKNIALLAERDRL
QLEMDAWHKANPGPIADMPAYRAFLESIGYLVPQPETVAVTTANVDAELAVQAGPQLVVP
VLNARYALNAANARWGSLYDALYGTDAIPETDGAEKGKGYNPVRGAKVIAFARNLLDQAA
PLSTGSHKDATGYSIEGGQLVVTQASGMSGLQDPAQLVGYRGDAAAPSSVLLVHNGLHID
IIIDRATTLGKSDAAGISDMVIESALSTILDLEDSVAVVDAEDKVLAYGNWLGILQGTLT
EEVSKGGTTFTRGLNPDRVYTAADGGEVTLHGRSLMFVRNVGHLMTNPAILYAGGKEIPE
GIMDAVVTTTIAIHDFKRQGQPGIKNSRTGSVYIVKPKMHGPAEVAFAAELFGRVEALLG
LPANTVKLGIMDEERRTSVNLKACIAEAEARVAFINTGFLDRTGDEMHTAMQAGPMIRKG
DMKTSAWIAAYEKNNVLVGLSCGLRGKAQIGKGMWAMPDLMAAMLEQKIGHPKAGANTAW
VPSPTAATLHALHYHQVLVSDVQKELEKIDANAERGNLLNGLLQIPVTATPNWSDAEKQQ
ELDNNAQGILGYVVRWIDQGVGCSKVPDIHNIALMEDRATLRISSQHMANWLHHGVVTEA
QVKETFERMAAVVDGQNAGDPLYKNMAGHFDTSAAYKAACDLVFKGLEQPSGYTEPLLHA
WRLKVKAGTA
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacgcaccacccgccacagcctgcaggtcgccaccgaactctatcgcttcatc
gaagacaaggtgctgcccggcaccggcgtggacagcgacaagttctggagcggctttgac
gccatcgtcgccgacctggccccgaaaaacatcgccctgctggccgagcgcgaccgcctg
cagcttgaaatggacgcctggcacaaggccaaccccggccccatcgccgacatgcccgcc
taccgcgcctttctcgaaagcatcggctacctcgtgccgcagcccgaaaccgtggccgtg
accaccgccaatgtcgatgccgaactggccgtgcaggccggcccgcagctcgtcgtgccg
gtgctcaatgcgcgctacgccctgaacgccgccaatgcgcgctggggttcgctgtatgac
gcgctctacggcaccgacgccattcccgaaaccgacggcgctgaaaaaggcaagggctac
aacccggtgcgcggcgcgaaagtgattgccttcgcccgcaacttgctcgaccaggccgcg
ccgctgagcaccggctcgcacaaggacgcgaccggctacagcatcgaaggcggccagttg
gtcgtcacgcaggcaagcggcatgagcggcctgcaagacccggcgcagctggtcggctac
cggggcgacgcggcggccccgtcgtcggtgctgctggtgcacaacggcctgcacatcgac
atcatcatcgaccgcgccacgaccctgggcaagagcgacgcggccggcatcagcgacatg
gtgatcgaatcggcgctctcgaccattcttgacctggaagactcggtggccgtggtcgat
gccgaggacaaggtgctggcctacggcaactggctcggcatcctgcagggcacgctgacc
gaggaagtcagcaagggcggcacgaccttcacgcgcggcctgaacccggaccgcgtgtac
accgctgccgacggcggcgaagtcacgctgcacggccgctcgctgatgttcgttcgcaat
gtcggccacctgatgacgaatccggccatcctgtatgcaggcggcaaggagattcccgaa
ggcatcatggacgcggtcgtcaccaccaccatcgccatccacgacttcaagcgccagggc
cagcccggcatcaagaactcgcgcaccggcagcgtctatatcgtcaagcccaagatgcac
ggcccggccgaagtcgcctttgccgccgagctgttcggccgcgtcgaagcgctgctgggc
ctgcccgccaacaccgtgaagctcggcatcatggacgaggagcgccgcaccagcgtcaac
ctgaaagcctgcatcgccgaagccgaagcgcgcgtggccttcatcaacaccggtttcttg
gaccgcacaggcgacgagatgcacaccgccatgcaggccggcccgatgatccgcaagggc
gacatgaagaccagcgcctggattgccgcttacgagaagaacaacgtgcttgtcggcctc
tcctgcggcctgcgcggcaaggcgcagatcggcaagggcatgtgggccatgcccgacctg
atggccgccatgctggagcagaaaatcggccacccgaaagccggcgccaacaccgcctgg
gtgcccagcccgacggcggccacgctgcacgcgctgcattaccaccaggtcctggtgtcc
gacgtgcaaaaggagctggaaaagatcgacgccaacgccgagcgcggcaacctcctgaac
ggcctgctgcaaatcccggtcaccgccacgccgaactggtcggatgccgagaagcagcag
gaactcgacaacaacgcgcagggcatcctgggctacgtggtgcgctggatcgaccagggc
gtgggctgctcgaaagtgcccgacatccacaacatcgcgctgatggaagaccgcgccacg
ctgcgcatctccagccagcacatggccaactggctgcaccacggcgtggtgaccgaagcg
caggtcaaggaaaccttcgagcgcatggccgccgtggtcgatggccagaacgcgggcgac
ccgctgtacaagaacatggccgggcacttcgacacgtcggccgcgtacaaggcggcgtgc
gacctggtgttcaaggggctggagcagccgagcggctacaccgagccgctgctgcatgcg
tggcgtttgaaggtcaaggctggcacggcctga

DBGET integrated database retrieval system