KEGG   Polaromonas naphthalenivorans: Pnap_3683Help
Entry
Pnap_3683         CDS       T00459                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
pna  Polaromonas naphthalenivorans
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pna00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pnap_3683
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Pnap_3683
   00630 Glyoxylate and dicarboxylate metabolism
    Pnap_3683
Enzymes [BR:pna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Pnap_3683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3918792..3920984)
Genome map
AA seq 730 aa AA seqDB search
MTERTTRHSLQVATELYRFIEDKVLPGTGVDSDKFWSGFDAIVADLAPKNIALLAERDRL
QLEMDAWHKANPGPIADMPAYRAFLESIGYLVPQPETVAVTTANVDAELAVQAGPQLVVP
VLNARYALNAANARWGSLYDALYGTDAIPETDGAEKGKGYNPVRGAKVIAFARNLLDQAA
PLSTGSHKDATGYSIEGGQLVVTQASGMSGLQDPAQLVGYRGDAAAPSSVLLVHNGLHID
IIIDRATTLGKSDAAGISDMVIESALSTILDLEDSVAVVDAEDKVLAYGNWLGILQGTLT
EEVSKGGTTFTRGLNPDRVYTAADGGEVTLHGRSLMFVRNVGHLMTNPAILYAGGKEIPE
GIMDAVVTTTIAIHDFKRQGQPGIKNSRTGSVYIVKPKMHGPAEVAFAAELFGRVEALLG
LPANTVKLGIMDEERRTSVNLKACIAEAEARVAFINTGFLDRTGDEMHTAMQAGPMIRKG
DMKTSAWIAAYEKNNVLVGLSCGLRGKAQIGKGMWAMPDLMAAMLEQKIGHPKAGANTAW
VPSPTAATLHALHYHQVLVSDVQKELEKIDANAERGNLLNGLLQIPVTATPNWSDAEKQQ
ELDNNAQGILGYVVRWIDQGVGCSKVPDIHNIALMEDRATLRISSQHMANWLHHGVVTEA
QVKETFERMAAVVDGQNAGDPLYKNMAGHFDTSAAYKAACDLVFKGLEQPSGYTEPLLHA
WRLKVKAGTA
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacgcaccacccgccacagcctgcaggtcgccaccgaactctatcgcttcatc
gaagacaaggtgctgcccggcaccggcgtggacagcgacaagttctggagcggctttgac
gccatcgtcgccgacctggccccgaaaaacatcgccctgctggccgagcgcgaccgcctg
cagcttgaaatggacgcctggcacaaggccaaccccggccccatcgccgacatgcccgcc
taccgcgcctttctcgaaagcatcggctacctcgtgccgcagcccgaaaccgtggccgtg
accaccgccaatgtcgatgccgaactggccgtgcaggccggcccgcagctcgtcgtgccg
gtgctcaatgcgcgctacgccctgaacgccgccaatgcgcgctggggttcgctgtatgac
gcgctctacggcaccgacgccattcccgaaaccgacggcgctgaaaaaggcaagggctac
aacccggtgcgcggcgcgaaagtgattgccttcgcccgcaacttgctcgaccaggccgcg
ccgctgagcaccggctcgcacaaggacgcgaccggctacagcatcgaaggcggccagttg
gtcgtcacgcaggcaagcggcatgagcggcctgcaagacccggcgcagctggtcggctac
cggggcgacgcggcggccccgtcgtcggtgctgctggtgcacaacggcctgcacatcgac
atcatcatcgaccgcgccacgaccctgggcaagagcgacgcggccggcatcagcgacatg
gtgatcgaatcggcgctctcgaccattcttgacctggaagactcggtggccgtggtcgat
gccgaggacaaggtgctggcctacggcaactggctcggcatcctgcagggcacgctgacc
gaggaagtcagcaagggcggcacgaccttcacgcgcggcctgaacccggaccgcgtgtac
accgctgccgacggcggcgaagtcacgctgcacggccgctcgctgatgttcgttcgcaat
gtcggccacctgatgacgaatccggccatcctgtatgcaggcggcaaggagattcccgaa
ggcatcatggacgcggtcgtcaccaccaccatcgccatccacgacttcaagcgccagggc
cagcccggcatcaagaactcgcgcaccggcagcgtctatatcgtcaagcccaagatgcac
ggcccggccgaagtcgcctttgccgccgagctgttcggccgcgtcgaagcgctgctgggc
ctgcccgccaacaccgtgaagctcggcatcatggacgaggagcgccgcaccagcgtcaac
ctgaaagcctgcatcgccgaagccgaagcgcgcgtggccttcatcaacaccggtttcttg
gaccgcacaggcgacgagatgcacaccgccatgcaggccggcccgatgatccgcaagggc
gacatgaagaccagcgcctggattgccgcttacgagaagaacaacgtgcttgtcggcctc
tcctgcggcctgcgcggcaaggcgcagatcggcaagggcatgtgggccatgcccgacctg
atggccgccatgctggagcagaaaatcggccacccgaaagccggcgccaacaccgcctgg
gtgcccagcccgacggcggccacgctgcacgcgctgcattaccaccaggtcctggtgtcc
gacgtgcaaaaggagctggaaaagatcgacgccaacgccgagcgcggcaacctcctgaac
ggcctgctgcaaatcccggtcaccgccacgccgaactggtcggatgccgagaagcagcag
gaactcgacaacaacgcgcagggcatcctgggctacgtggtgcgctggatcgaccagggc
gtgggctgctcgaaagtgcccgacatccacaacatcgcgctgatggaagaccgcgccacg
ctgcgcatctccagccagcacatggccaactggctgcaccacggcgtggtgaccgaagcg
caggtcaaggaaaccttcgagcgcatggccgccgtggtcgatggccagaacgcgggcgac
ccgctgtacaagaacatggccgggcacttcgacacgtcggccgcgtacaaggcggcgtgc
gacctggtgttcaaggggctggagcagccgagcggctacaccgagccgctgctgcatgcg
tggcgtttgaaggtcaaggctggcacggcctga

DBGET integrated database retrieval system