KEGG   Polaromonas naphthalenivorans: Pnap_3772Help
Entry
Pnap_3772         CDS       T00459                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
pna  Polaromonas naphthalenivorans
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pna00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pnap_3772
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Pnap_3772
Enzymes [BR:pna01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Pnap_3772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4024973..4025890
Genome map
AA seq 305 aa AA seqDB search
MTQHIRLIGAPTDVGAGTRGASMGPEAFRVAGLQPTLEGHGLRVTDRGNINGPANPWQAP
VSGYRHLAEVAAWNHAVHKEVHAALSEGEMPMLLGGDHCLAIGSISAVARHCRRLGKTLR
VLWLDAHTDFNTDALTPTGNTHGMPVAVLCGHGPAELTGIGGVSPALQPSAIRQIGIRSV
DAGEKRFVRESGLEVFDMRYIDEMGMRHTMEAALAGIDDSTHLHVSFDVDFLDASFAPGV
GTAVKGGPTYREAQLCMEMIADTGRMASLDVMELNPALDVRNATAEVALELIESLFGKST
LMRRS
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgacacagcacatcaggcttattggcgcacccaccgatgtcggagcgggcacgcgcggc
gcgtccatgggcccggaggccttccgcgttgccggcctgcagcccacgctcgaaggccac
ggcctgcgcgtcaccgaccggggaaacatcaacggcccggccaacccgtggcaggcgccg
gtcagcggctaccggcacctggccgaggtggcggcctggaaccatgccgtccacaaggag
gttcatgcagcgctgagcgagggcgagatgcccatgctgctgggcggcgaccactgcctg
gccatcggctcgatcagcgcggtggcgcgccattgccgccggcttggcaaaaccctgcgc
gtgctgtggctcgatgcgcacaccgacttcaacaccgatgcgctgacaccgaccggcaat
acgcacggcatgccggtggcggtgctgtgcggccatgggcctgccgagttgaccggcata
ggcggggtgtcgcccgccttgcagccttcggccattcgccagatcggcatccgcagcgtg
gacgctggggaaaaacgcttcgtcagggagtcggggctcgaagtgttcgacatgcgctac
atcgacgagatgggcatgcggcacaccatggaagcggcgctggccggcatcgacgacagc
acgcacctgcatgtgagctttgatgtggactttctggacgccagctttgcacccggcgtc
ggcacggcggtcaagggcggaccgacctaccgcgaagcccagttgtgcatggagatgatc
gccgacaccgggcgcatggcgtcgctcgacgtgatggagttgaacccggcgctggatgtg
cgcaatgccacggcggaagtggcgcttgagctgattgaaagcctgtttggtaaaagcacg
ctgatgcggcgctcctga

DBGET integrated database retrieval system