KEGG   Polaromonas naphthalenivorans: Pnap_3772Help
Entry
Pnap_3772         CDS       T00459                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
pna  Polaromonas naphthalenivorans
Pathway
pna00220  Arginine biosynthesis
pna00330  Arginine and proline metabolism
pna01100  Metabolic pathways
pna01110  Biosynthesis of secondary metabolites
pna01130  Biosynthesis of antibiotics
pna01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pna00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Pnap_3772
   00330 Arginine and proline metabolism
    Pnap_3772
Enzymes [BR:pna01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Pnap_3772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ABM39068
UniProt: A1VTU0
Position
4024973..4025890
Genome map
AA seq 305 aa AA seqDB search
MTQHIRLIGAPTDVGAGTRGASMGPEAFRVAGLQPTLEGHGLRVTDRGNINGPANPWQAP
VSGYRHLAEVAAWNHAVHKEVHAALSEGEMPMLLGGDHCLAIGSISAVARHCRRLGKTLR
VLWLDAHTDFNTDALTPTGNTHGMPVAVLCGHGPAELTGIGGVSPALQPSAIRQIGIRSV
DAGEKRFVRESGLEVFDMRYIDEMGMRHTMEAALAGIDDSTHLHVSFDVDFLDASFAPGV
GTAVKGGPTYREAQLCMEMIADTGRMASLDVMELNPALDVRNATAEVALELIESLFGKST
LMRRS
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgacacagcacatcaggcttattggcgcacccaccgatgtcggagcgggcacgcgcggc
gcgtccatgggcccggaggccttccgcgttgccggcctgcagcccacgctcgaaggccac
ggcctgcgcgtcaccgaccggggaaacatcaacggcccggccaacccgtggcaggcgccg
gtcagcggctaccggcacctggccgaggtggcggcctggaaccatgccgtccacaaggag
gttcatgcagcgctgagcgagggcgagatgcccatgctgctgggcggcgaccactgcctg
gccatcggctcgatcagcgcggtggcgcgccattgccgccggcttggcaaaaccctgcgc
gtgctgtggctcgatgcgcacaccgacttcaacaccgatgcgctgacaccgaccggcaat
acgcacggcatgccggtggcggtgctgtgcggccatgggcctgccgagttgaccggcata
ggcggggtgtcgcccgccttgcagccttcggccattcgccagatcggcatccgcagcgtg
gacgctggggaaaaacgcttcgtcagggagtcggggctcgaagtgttcgacatgcgctac
atcgacgagatgggcatgcggcacaccatggaagcggcgctggccggcatcgacgacagc
acgcacctgcatgtgagctttgatgtggactttctggacgccagctttgcacccggcgtc
ggcacggcggtcaagggcggaccgacctaccgcgaagcccagttgtgcatggagatgatc
gccgacaccgggcgcatggcgtcgctcgacgtgatggagttgaacccggcgctggatgtg
cgcaatgccacggcggaagtggcgcttgagctgattgaaagcctgtttggtaaaagcacg
ctgatgcggcgctcctga

DBGET integrated database retrieval system