KEGG   Polaromonas naphthalenivorans: Pnap_3912Help
Entry
Pnap_3912         CDS       T00459                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pna  Polaromonas naphthalenivorans
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:pna00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:pna00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4176514..4177083
Genome map
AA seq 189 aa AA seqDB search
MAWALIASAALAATFPAGAASLDAPSTPPSCPALLQQNVLRLQDEKPQSLCQYSGKVVVV
VNTASFCGFTPQYKGLEALHAKYQGRGLVVLGFPSNDFSQETGSNKEIADFCENTFGVKF
PMFTKTRVTGKDASPLFKQLADKTGTAPRWNFYKYIIARDGTAVAAFNSMTDPAGGKFVA
EIEKQLARP
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
gtggcttgggcgctcattgccagcgctgcgctggccgccactttccccgcaggcgcggcc
agccttgacgcgccgtccacgccgccgtcctgccccgcgcttttgcaacaaaacgtgctg
cgcctgcaggatgaaaaaccgcagtcgctgtgccagtacagcggcaaggtcgtggtagtc
gtcaacaccgccagcttttgcggctttaccccgcagtacaagggcctggaagcgctgcat
gccaaataccaggggcgcggcctggtggtgctgggctttccgtccaatgacttttcgcag
gaaaccggcagcaacaaggagattgccgacttttgcgagaacaccttcggcgtgaaattc
ccgatgttcaccaagacccgcgtgaccggcaaggacgccagcccgctctttaaacagctg
gccgacaagaccggcaccgcgccgcgctggaacttctacaaatacatcattgcgcgcgac
ggcacggcggtggccgccttcaattccatgaccgacccggcaggcggcaagttcgtggcc
gaaatcgaaaagcagctggccaggccatga

DBGET integrated database retrieval system