KEGG   Polaromonas naphthalenivorans: Pnap_4494Help
Entry
Pnap_4494         CDS       T00459                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pna  Polaromonas naphthalenivorans
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pna00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Pnap_4494
Enzymes [BR:pna01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Pnap_4494
Peptidases [BR:pna01002]
 Cysteine Peptidases
  Family C44
   Pnap_4494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pPNAP02:60942..62774
Genome map
AA seq 610 aa AA seqDB search
MCGICGELRFDGSTVDMSAIERMSDRIARRGPDHAGIFSDGALALGHRRLAIIDLSADGD
QPMIDEELKLVLVFNGTIYNYKELRAELIAMGYRFFSESDSEVILKAYHAWGAQCVQRFF
GMFAFAVWDQRDARLFMARDRFGIKPLYYTMDGSRLRFASSLQALLAAGGVDTGIDPVAL
HHHFTLHAVVPAPRTILKGVRKLGPATTMTINGSGHIEEAIYWKLDATRPAQALSEAQWL
AATREVLVRAVERHRLAADVPVGVLLSGGLDSSLLVGLLADHVDDLQTFSMGFETLGEGG
EKADEFEFSDQVAEQFGTRHHKYLIPYDEVLRRLPEAVLQMSEPMVSQDVIAFYLLGERV
SKQVKVVLSGQGADEVFGGYFWYPRMDAAKGSALARFSAHYFDRDHDEYLEMVTPAYHLP
DVTAALVAKALAQPQADTFIDQVLRFDATTLVVDDPVKRVDNMAMAWGLEARVPFLDHEL
VELAARMPPELKLRQGGKFPLKAISRGLISDAVIDRPKGYFPVPVLKHVSGEFLAFMRGI
LNSDACIRRGLYQRAYVEKLLAAPEAWFTRIQGSKLWHLALLELWLQLNVDEPYGSASST
GPSQARTETP
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatctgcggtgaattgcgctttgacggttcgacggtcgacatgtcggcgatc
gaacgcatgtctgacaggatcgcccgacgcggcccggaccacgccggaatcttcagcgac
ggcgcgctggccttgggccaccgccgcctggcgatcatcgacctcagcgctgacggcgac
cagcccatgatcgacgaggaattgaagctggtgctggtcttcaacggcacgatctacaac
tacaaggaactgcgcgccgagctcatcgcgatgggctaccggttcttttccgagagcgac
agcgaagtcatcctgaaggcctatcacgcctggggtgcgcaatgcgtgcagcgcttcttc
ggcatgtttgcctttgcagtatgggaccagcgcgatgcgcgcctgttcatggcgcgcgac
cgcttcggcatcaaaccgctgtactacacgatggacggatcgcggttgcgcttcgcctcc
agcttgcaggccctgctggcagcgggcggtgtggacacgggcatcgacccggtggcgcta
caccaccatttcaccctgcatgcagtggtgcccgcaccgcgcaccatcctcaagggtgtc
aggaagctcggccccgctaccacgatgacgatcaatggctccggccacattgaagaggcc
atctactggaagctcgatgctacgcgcccggcgcaagccctgtccgaggcgcaatggctg
gctgccacccgtgaggtgctggtgcgggcggtggaacgccaccgcctcgccgccgatgta
cccgtgggtgtactgctctccggtggactggactccagcctgctcgtcggcctgctggct
gaccacgtggacgacctgcagaccttctcgatgggtttcgagacgctgggcgaagggggc
gaaaaggctgatgaattcgagttctccgaccaggtggcagaacaattcggaacgcgccac
cacaagtacctcattccctatgacgaagtgctgcgccgcctgcccgaagcggtattgcag
atgtccgaacccatggtgagccaggacgtgatcgccttttacctgctgggcgagcgtgtt
tctaagcaggtgaaggtggtgctttcaggccagggtgccgacgaagtcttcggtggctac
ttctggtacccccgaatggatgccgccaagggctcggctttggcgcgcttcagcgcccac
tactttgatcgggaccacgacgagtaccttgagatggtcactcccgcttatcacctgccc
gacgtgacggccgcgctggtggcgaaagccttggcacagccgcaggccgacaccttcatc
gatcaggtactgcgcttcgacgccaccacgctggtggtggacgaccccgtcaagcgcgtg
gacaacatggcgatggcctggggcctggaagcgcgtgtgccattcctggaccacgaactg
gtggagctggcagcgcgcatgcccccggagctcaagctcaggcagggcggcaagttcccg
ctcaaggcgatctcccgaggtttgatttcggacgccgtgatcgaccggccgaaaggctat
ttcccggtgccggtgctgaaacacgtgagcggcgagttcctggccttcatgcgtggcatc
ctcaattcagacgcctgtatccggcgcggcctgtaccaacgagcctatgttgagaagctg
ctcgcggcacccgaagcctggttcacccgcatccagggcagcaagctatggcatctggcg
ctgctcgagctgtggctgcaattgaacgtcgacgaaccttatggctcggcatcatcaaca
ggcccatcccaggccagaacggagaccccatga

DBGET integrated database retrieval system