KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_0036Help
Entry
NCGM2_0036        CDS       T01974                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pnc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NCGM2_0036 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NCGM2_0036 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NCGM2_0036 (trpB)
Enzymes [BR:pnc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NCGM2_0036 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
1:complement(37969..39177)
Genome map
AA seq 402 aa AA seqDB search
MTSYRNGPDAKGLFGRFGGQYVAETLMPLILDLAREYEKAKDDPAFQEELAYFQRDYVGR
PSPLYFAERLTEHCGGAKIYLKREELNHTGAHKINNCIGQILLARRMGKKRIIAETGAGM
HGVATATVAARFGLQCVIYMGTTDIDRQQANVFRMKLLGAEVIPVTAGTGTLKDAMNEAL
RDWVTNVDSTFYLIGTVAGPHPYPAMVRDFQAVIGKETREQLAEKEGRLPDSLVACIGGG
SNAMGLFHPFLDDAGVQIVGVEAAGHGIDTGKHAASLNGGVPGVLHGNRTFLLQDADGQI
IDAHSISAGLDYPGIGPEHAWLHDTGRVEYTSITDDEALEAFHTCCRLEGIIPALESSHA
LAEVFKRAPSLPKEHIMVVNLSGRGDKDMQTVMHHMQQESKA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgacttcctatcgcaacggccccgacgccaagggcctgttcggccgcttcggcggccag
tacgtcgccgagaccctgatgccgctgatcctcgacctcgcccgcgagtacgagaaggcc
aaggacgacccggcgttccaagaggaactggcctacttccagcgcgactacgtcggtcgg
ccgagcccgctgtacttcgccgagcgcctgaccgagcactgcggcggggcgaagatctac
ctcaagcgcgaggagctgaaccataccggcgcgcacaagatcaacaactgcatcggccag
atcctcctggcccggcgcatgggcaagaaacgcatcatcgccgagaccggcgccggcatg
cacggcgtggccaccgccactgtcgccgcgcgtttcggcctgcagtgcgtgatctacatg
ggcaccaccgacatcgaccggcagcaggccaacgtcttccgcatgaagctgctgggcgcc
gaggtgatcccggtgaccgccggcaccggtaccctgaaggacgccatgaacgaggcgctg
cgcgattgggtgaccaacgtcgatagcaccttctacctgatcggcacggtcgccggcccg
catccgtacccggcgatggtccgcgacttccaggcggtgatcggcaaggaaacccgcgag
caactggccgagaaggaagggcgcctgcccgattcgctggtcgcctgcatcggcggcggc
tccaacgccatgggcctgttccacccgttcctcgacgacgccggggtgcagatcgtcggc
gtggaagccgccggccacggcatcgacaccggcaagcacgcggccagcctgaacggcggg
gttcccggcgtgctgcacggcaaccgcaccttcctgctgcaggatgcggatggccagatc
atcgacgcacactccatctccgccggcctcgactatcccggcatcggcccggaacacgcc
tggctgcacgacaccggccgcgtcgagtacacctcgatcaccgacgacgaagccctggag
gccttccacacctgctgccgcctcgaaggcatcatcccggcactggaaagctcccatgcc
ctggccgaggtcttcaagcgtgcgcccagcctgcccaaggagcacatcatggtggtgaac
ctgtccggtcgcggcgacaaggacatgcagaccgtcatgcaccacatgcaacaggagtcg
aaagcatga

DBGET integrated database retrieval system