KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_0056Help
Entry
NCGM2_0056        CDS       T01974                                 

Gene name
phzH
Definition
phenazine-modifying enzyme
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:pnc00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
70954..72786
Genome map
AA seq 610 aa AA seqDB search
MCGLAGWVDYTRKLDDEFPAIFAMTDTLALRGPDAEGIWKHRNALLGHRRLAVIDLSGGV
QPMSYRFPTGQEVTLVYTGEVYNHDALRERLRRAGHEFRTRSDTEVVLHAYLQWGERCCE
YLTGMFAFAVFDGRDGHLLLVRDRLGIKPLYYARHREGLLFGSEIKSILAHPEFAARLDA
VGLVDLLTLSRGTSQTPFREVQELLPGHLLSWRPNSQAKLRRYWEVRRQEHADDLQSTVQ
RTRELVTRALGSQLHADVPVCSLLSGGLDSTALTGIAQRIAKAEHGGDINSFSVDFVGQA
EQFRSDDLRPDQDQPFALLAAQYIGSRHRTVLIDNAELVCERAREEVFRAKDVPFTFGDM
DTSLHLMFGEIRRHSTVAISGEGADELFGGYGWFRDPQAVAAARFPWASRVHLPAGFIDA
GFNRRCDLLQYQQASYDDGLRQVEHLAGDSPEERRMREFSHLHLKRWMVLLLERKDRLSM
CNGLEVRVPYTDHELVEYVYNVPWSIKSRDGEEKWLLKRACADYVPEAVLKRRKSPYPTS
ANLGYERFLRGSVRRLLEDAANPVFGIVSREFLAAELEHPEGYFNTQVSRHNLETALALE
GWLRLYGLSA
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggtctcgcgggttgggtggattacacgcgcaagctcgacgacgaatttccggcg
atcttcgccatgaccgatacgctcgccttgcgcgggccggatgccgagggcatctggaag
caccgcaacgccctgctgggtcaccggcggctggcggtcatcgacctcagcggcggcgtg
cagccgatgtcctatcgctttcccaccggccaggaggtcaccctcgtctacaccggcgag
gtgtacaaccacgatgccctgcgcgagcggttgcgccgggccggacacgagttccgcacc
cgcagcgataccgaggtggtcctgcacgcctatctgcaatggggcgagcgttgttgcgag
tacctgaccgggatgttcgccttcgccgtcttcgacggccgcgacggccacctgctgctg
gtgcgcgaccgcttgggcatcaagccgctgtattacgcgcggcaccgcgagggactgctg
ttcggctcggagatcaagtccatcctggcgcatccggaattcgccgccaggctcgacgcg
gtcggcctggtcgacctcctgacgctgtcccggggcacttcgcagacgccgttccgcgag
gtccaggaactgctgcccggccacctgctgtcctggcgtcccaattcccaggcgaagtta
cgccgctactgggaggtgcgccgccaggagcatgccgacgacctgcagagcaccgtgcag
cgcacccgcgaactggtcacccgcgccctggggtcgcaattgcacgccgacgttccggtg
tgttcgctgctatcgggtgggctcgattcgaccgccctgaccggcatcgcccagcgcatc
gcgaaggcggagcacggcggcgacatcaattcattctcggtggacttcgtcggtcaggcc
gagcagttccgcagcgacgacctgcgtcccgaccaggaccagccgttcgccctgctggcc
gcgcagtacatcggcagccgtcatcgcaccgtgctcatcgacaatgccgaactggtctgc
gaacgagcgcgcgaagaggtattccgggccaaggacgtacctttcaccttcggcgacatg
gatacctcgctgcacctgatgttcggcgagatccgccggcattccacggtggccatctcc
ggcgaaggcgccgacgagctgttcggtggctacggctggttccgcgatccgcaggcggtg
gctgcggcgcgcttcccctgggcctccagggtgcatttgccggccggcttcatcgacgcc
ggtttcaaccgccgctgcgatctcctccagtaccagcaggccagctacgacgatgggctg
cgccaggtcgaacacctggccggcgacagcccggaggagcggcggatgcgcgagttcagc
cacctgcacctgaagcgctggatggtgctgctgctcgaacgcaaggatcgcctgagcatg
tgcaacggcctggaggtgcgggtgccctacaccgaccatgaactggtggagtacgtctac
aacgtgccctggtcgatcaagagccgggacggcgaggagaagtggctgctcaagcgggcc
tgcgccgactatgtcccggaagccgtgctcaagcgccgcaagagcccttatccgacttct
gccaacctcggctacgagcgtttcctgcgcgggagcgtgcggcgcttgctggaggacgcg
gcgaacccggtgttcggcatcgtttcgcgggagttcctggccgccgaactggagcatccg
gaggggtacttcaacacccaggtgagccgccacaacctggagaccgcgctggcgctggaa
ggctggctcaggttgtacgggctctccgcctga

DBGET integrated database retrieval system