KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_0230Help
Entry
NCGM2_0230        CDS       T01974                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pnc00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    NCGM2_0230
Enzymes [BR:pnc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     NCGM2_0230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(252462..253244)
Genome map
AA seq 260 aa AA seqDB search
MATTLELPKDQLIQHALKQMKSSLGDNTWTDRQKLALTCRILFEAGHDSGLAGQITSRGP
EAGTYYTQQLGLGFDEISAGNLLLVDEDLNVLHGHGMANPANRFHSWVYRARPDVNCIIH
THPLHIAALSTLEVPLQVSHMDLCPLYDDCAFLKDWPGVPVGNEEGEIISAALGDKRAIL
LSHHGLLATGASIEEACVIAVLLERAAKMQLLAMAAGEIKPIPPALAREAHDWISTPKRH
GAAFNYYARRCLPRNSDCLS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggctacgacactggaattacccaaggatcaactgatccagcacgcgctgaagcagatg
aaaagcagcctcggcgataatacgtggactgaccggcaaaagctggccctgacctgcagg
attctcttcgaggccggccacgactccgggctcgccgggcagatcacctcgcgcggcccg
gaggcggggacctactacacccagcaactgggcctgggcttcgacgagatcagcgccggc
aacctgctgctggtcgacgaagacctcaacgtcctccacgggcacggcatggcgaatccg
gccaatcgcttccacagctgggtctaccgcgcccgcccggacgtcaattgcatcatccac
acccacccgctgcacatcgccgcgctgtcgaccctggaagtaccgctgcaggtctcgcac
atggacctttgcccgctatacgacgactgcgccttcctcaaggactggccgggcgtgccg
gtaggcaacgaggaaggcgagatcatctccgccgccctcggcgacaagcgcgccatcctg
ctttcccaccacggcctgctggccaccggtgcgagcatcgaggaggcctgcgtgatcgcg
gtgctgctcgagcgcgcggcgaagatgcagttgctggcgatggccgccggggagatcaag
ccgatcccgccggccctggcgcgcgaggcccacgactggatctccaccccgaagcgccac
ggcgccgcattcaactactacgcccggcgctgcctgccgcgcaacagcgactgcctgagc
tga

DBGET integrated database retrieval system