KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_0323Help
Entry
NCGM2_0323        CDS       T01974                                 

Gene name
speB1
Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:pnc00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    NCGM2_0323 (speB1)
Enzymes [BR:pnc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     NCGM2_0323 (speB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(365830..366786)
Genome map
AA seq 318 aa AA seqDB search
MSNDHPQPLDAAEIPRFAGIPTFMRLPAFTDPAALQVGLIGVPWDGGTTNRAGARHGPRE
VRNLSSLMRKVHHVSRIAPYDLVRVGDLGDAPVNPIDLLDSLRRIEGFYRQVHAAGTLPL
SVGGDHLVTLPIFRALGRERPLGMVHFDAHSDTNDRYFGDNPYTHGTPFRRAIEEGLLDP
LRTVQIGIRGSVYSPDDDAFARECGIRVIHMEEFVELGVEATLAEARRVVGAGPTYVSFD
VDVLDPAFAPGTGTPEIGGMTSLQAQQLVRGLRGLDLVGADVVEVSPPFDVGGATALVGA
TIMFELLCLLAESAARSA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacgaccatccgcagcccctcgacgccgccgagattccccgcttcgccggtatc
ccgaccttcatgcgcctgccggcgttcaccgacccggcggcgctgcaggtcggcctgatc
ggcgtgccctgggacggcggcaccaccaaccgcgccggtgcccgccatggcccgcgcgag
gtgcgcaacctgtccagcctgatgcgcaaggtgcatcacgtcagccgcatcgcgccctac
gacctggtgcgggtcggcgatctcggcgacgcgccggtgaatcccatcgacctgctcgat
tcgctgcgccgcatcgaaggcttctatcgccaggtccatgccgccggtaccctgccgctg
tcggtcggtggcgaccacctggtgaccctgccgatctttcgcgccctgggtcgcgagcgg
ccgctgggcatggtgcatttcgatgcgcattccgataccaacgaccgctacttcggcgac
aacccctacacccacggcacgccattccgccgagccatcgaggaaggcctgctcgatccg
ctgcgcacggtgcagatcggcatccgcggctcggtgtattcgccggacgacgacgctttc
gcccgcgagtgcggcatccgcgtgatccacatggaggagttcgtcgaactgggcgtcgag
gcgaccctggccgaagcgcggcgggtggtgggcgccgggccgacctatgtgagtttcgac
gtcgacgtgctcgacccggccttcgcgcccggcaccggcaccccggagatcggcggcatg
accagcctccaggcccagcagctggtccgcggcctgcgcgggctggacctggtcggcgcc
gacgtggtggaagtctcgccgccgttcgatgtcggcggcgccacggcgctggtgggggcg
accataatgttcgagctgctctgcctgcttgccgagtcggccgcgcgaagcgcctga

DBGET integrated database retrieval system