KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_0747Help
Entry
NCGM2_0747        CDS       T01974                                 

Gene name
yfcY
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:pnc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    NCGM2_0747 (yfcY)
   00630 Glyoxylate and dicarboxylate metabolism
    NCGM2_0747 (yfcY)
   00640 Propanoate metabolism
    NCGM2_0747 (yfcY)
   00650 Butanoate metabolism
    NCGM2_0747 (yfcY)
  Lipid metabolism
   00071 Fatty acid degradation
    NCGM2_0747 (yfcY)
   00072 Synthesis and degradation of ketone bodies
    NCGM2_0747 (yfcY)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NCGM2_0747 (yfcY)
   00310 Lysine degradation
    NCGM2_0747 (yfcY)
   00380 Tryptophan metabolism
    NCGM2_0747 (yfcY)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NCGM2_0747 (yfcY)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    NCGM2_0747 (yfcY)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    NCGM2_0747 (yfcY)
Enzymes [BR:pnc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     NCGM2_0747 (yfcY)
Exosome [BR:pnc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NCGM2_0747 (yfcY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1:823498..824775
Genome map
AA seq 425 aa AA seqDB search
MTQLRRVAIVGGNRIPFARSNTVYATASNQEMLTSALEGLVERYNLHGERLGEVVAGAVL
KHSRDFNLTRECVLGSRLAPETPAYDIQQACGTGLEAAILVANKIALGQIDSGIAGGVDT
TSDAPIGVNEGLRKILLEANRGKSNLDKLKSLLKIRPRHVVPAIPRNGEPRTGLSMGESC
ELMAQTWQIPRDEQDRLAFESHHKLAAAYEEGWQNDLMTPFRGLTRDQNLRPDIDLEKIG
TLKPVFERGSRGTLTAANSTPLTDGASVVLLASEEWAKARGLPILAYFKDGEAAAVNFVD
RQEGLLMAPVYAVPRLLARNGLSLQDFDYYEIHEAFAAQVLCTLKAWEDPEYCKTRLGLD
QPLGSIDRSKLNVKGSSLAAGHPFAATGGRIVANLAKLLSVAEQGRGLISICAAGGQGVT
AIIER
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgacccagctgcgccgggtcgccattgtcggcggcaaccgtattcccttcgcccgctcg
aacaccgtgtacgccacggcgagcaaccaggagatgctcacttccgccctggaaggcctg
gtggagcgctacaacctgcacggagagcgccttggcgaggtggtggccggcgccgtgctg
aagcattcgcgcgacttcaacctgacccgcgaatgcgtgctcggttcgcgcctggccccg
gaaaccccggcctacgatatccagcaggcctgcggtaccggcctggaggcggcgatcctg
gtggccaacaagatcgccctcgggcagatcgacagcggcatcgccggcggcgtcgacacc
acttccgacgcgccgatcggggtcaacgaggggctgcgcaagattctcctcgaggccaac
cgtggcaagagcaacctggacaagctcaagagcctgttgaagatccgcccgcgccacgtg
gtcccggccatcccgcgcaacggcgagccgcgcaccgggctgtcgatgggggagtcctgc
gaactgatggcgcagacctggcagattccccgcgacgagcaggacaggctggccttcgag
agccaccacaagctggccgcggcctatgaggagggctggcagaacgacctgatgacgccg
ttccgcggcctgacccgcgaccagaacctgcgcccggatatcgacctggagaagatcggc
accctcaagccggtgttcgagcgcggctcgcgcggcaccctcacggcggccaactcgacg
ccgctgaccgacggcgcctcggtggtactgctggccagcgaggagtgggcgaaggcgcgc
ggcctgccgatcctggcctacttcaaggacggcgaggcggcggcggtgaacttcgtcgat
cgccaggagggcctgctgatggcgccggtctacgcggtgccgcggctgctggcacgcaac
ggcttgagcctgcaggacttcgactactacgagatccacgaggccttcgccgcccaggtg
ctctgcaccctgaaggcctgggaagaccccgagtactgcaagacccgtctcggcctcgac
cagccgctgggctccatcgaccgcagcaagctcaacgtcaagggcagctcgctggccgcc
ggccacccgttcgccgccaccggaggacggatcgtcgccaacctggccaagctgctctcg
gtggcggagcagggacgcgggttgatttccatctgcgccgccggtgggcagggtgtgacc
gcgatcatcgagcggtaa

DBGET integrated database retrieval system