KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_0806Help
Entry
NCGM2_0806        CDS       T01974                                 

Gene name
acsB
Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
pnc00010  Glycolysis / Gluconeogenesis
pnc00620  Pyruvate metabolism
pnc00640  Propanoate metabolism
pnc00680  Methane metabolism
pnc01100  Metabolic pathways
pnc01110  Biosynthesis of secondary metabolites
pnc01120  Microbial metabolism in diverse environments
pnc01130  Biosynthesis of antibiotics
pnc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pnc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NCGM2_0806 (acsB)
   00620 Pyruvate metabolism
    NCGM2_0806 (acsB)
   00640 Propanoate metabolism
    NCGM2_0806 (acsB)
  Energy metabolism
   00680 Methane metabolism
    NCGM2_0806 (acsB)
Enzymes [BR:pnc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     NCGM2_0806 (acsB)
Lipid biosynthesis proteins [BR:pnc01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   NCGM2_0806 (acsB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: BAK87689
Position
1:complement(879796..881733)
Genome map
AA seq 645 aa AA seqDB search
MFEISVHPVPDAVRQRAYLNDDDYQRLYRQSVENPDEFWGEQAKAFLDWFKPWHSVHHGD
LRKGQATWFKGGQLNVAYNCIDRHLERRGEQIAIVWEGDNPSESAHITYRKLHHNVCRLA
NVLKSRGVEKGDRVCIYMPMIPEAAYAMLACARIGAVHSVVFGGFSPDSLRDRILDADCR
TVITADEGVRGGKYIPLKQNVEKALKDCPDVSTVVVVERTQGDIPWVEGRDIWYHEALHA
ASADCPAEAMDAEDPLFILYTSGSTGKPKGVLHTTGGYLLGAAMTHKYVFDYHDGDVYWC
TADVGWVTGHSYIVYGPLANGATTLMFEGVPNYPDASRFWQVIDKHQVNIFYTAPTAIRA
LMREGDAPVRQTSRSSLRLLGSVGEPINPEAWEWYYQVVGEKRCPIVDTWWQTETGSILI
TPLPGATALKPGSATRPFFGVQPVLLDEKGKEIDGAGSGVLAIKASWPSQIRSVYGDHQR
MIDTYFKPYPGYYFSGDGARRDEDGYYWITGRVDDVINVSGHRIGTAEVESALVLHDAVA
EAAVVGCPHDVKGQAIYAFVTLMAGSQPSEALQQELLALVGKEIGSFAKPDHLQWAPSLP
KTRSGKIMRRILRKIACNELDSLGDTSTLADPGVVQGLIDNRLNR
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgttcgagatcagcgtccacccggtgccggacgccgtccgccagcgtgcctacctgaac
gacgacgactaccagcgcctgtaccgccaatccgtcgagaaccccgacgagttctggggc
gagcaggccaaggccttcctcgattggttcaagccctggcacagcgtccaccacggcgac
ctgaggaaaggccaggccacctggttcaagggcggccagttgaacgtcgcctacaactgc
atcgaccgccacctggaacgccgcggcgaacagatcgcgatcgtctgggaaggcgacaac
cccagcgaatccgcgcacatcacctaccgcaagctgcaccacaacgtctgccgcctggct
aacgtgctgaagagccgcggcgtggaaaagggcgaccgggtctgcatctacatgccgatg
attcccgaggccgcctacgccatgctcgcctgcgcccgcatcggggcggtgcactcggtg
gtgttcggcggcttctcgccggactcgctgcgcgaccgcatcctcgatgccgactgccgc
accgtgatcaccgccgacgagggcgtgcgcggcggcaagtacatcccgctgaagcagaat
gtggaaaaggcgctgaaggactgcccggacgtctccaccgtggtggtggtcgagcgcacc
cagggcgacataccctgggtcgaaggccgcgacatctggtaccacgaggcgctccacgcg
gcctcagccgactgcccggcggaagcgatggacgccgaggacccgctgttcatcctctat
acctccggcagcaccggcaagccgaagggcgtattgcacaccaccgggggctacctgctc
ggcgcggcgatgacccacaagtacgtgttcgactaccacgatggcgacgtctactggtgc
accgccgacgtcggctgggtcaccggacacagctatatcgtctacggcccgctggccaac
ggcgccaccaccctgatgttcgagggcgtgcccaactacccggacgcctcgcgtttctgg
caggtgatcgacaagcaccaggtgaatatcttctacaccgcgccgaccgcgatccgcgcg
ctgatgcgcgaaggcgacgccccggtccgccagacctcgcgcagcagcctgcgcctgctc
ggctcggtgggcgagccgatcaacccggaggcctgggagtggtactaccaggtggtcggc
gagaagcgctgccccatcgtcgacacctggtggcagaccgagaccggcagcatcctgatc
accccgttgcccggcgccactgcgctgaagccaggctcggcgacccgcccgttcttcggc
gtgcaacccgtgctgctcgacgagaaaggcaaggaaatcgacggcgcgggcagcggcgta
ctggcgatcaaggccagttggccgagtcagatccgcagcgtctacggcgaccaccagcgg
atgatcgacacctacttcaagccctaccccgggtattacttcagcggcgacggcgcgcgc
cgcgacgaggacggctactactggatcaccggccgggtcgacgacgtgatcaatgtctcc
ggacaccggatcggcaccgccgaggtcgagagcgcgctggtcctgcacgatgcggtggcc
gaggcggcagtggtcggctgcccgcatgacgtgaagggccaggccatctacgcgttcgtc
accctgatggccggcagtcagcccagcgaggcgctgcaacaggaattgctggccctggtc
ggcaaggagatcggcagcttcgccaagccggatcacctgcaatgggcgcccagcctgccg
aagacccgctccggcaagatcatgcggcgtatcctgcgcaagatcgcctgcaacgagctg
gacagtctcggcgatacctcgaccctggccgatccgggagtggtgcaggggttgatcgac
aaccgcctcaaccgctga

DBGET integrated database retrieval system