KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_1031Help
Entry
NCGM2_1031        CDS       T01974                                 

Gene name
proB
Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pnc01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pnc00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1129106..1130224
Genome map
AA seq 372 aa AA seqDB search
MRDKVTGARRWVVKIGSALLTADGRGLDRNAMAVWVEQMVALHCAGIELVLVSSGAVAAG
MSRLGWVSRPSAMHELQAAASVGQMGLVQAWESSFALHGLQTAQVLLTHDDLSDRKRYLN
ARSTLRTLVELGVVPVINENDTVVTDEIRFGDNDTLAALVANLVEADLLVILTDRDGMFD
ADPRNNPDAQLIYEARADDPQLDAVAGGSAGALGRGGMQTKLRAARLAARSGGHTVIVGG
RIERVLDRLRAGERLGTLLTPDRSRKAARKQWLAGHLQMRGTLVLDDGAVKAVSQDHKSL
LPVGVKAVQGSFRRGEMVVCVDQGGREVARGLVNYSALEAQKILGQPTDAIEALLGYVDG
PELVHRDNLVLV
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcgggacaaggtgactggcgcgcggcgctgggtggtgaagatcggtagcgccctgctg
acggccgatggccgtgggctggatcgcaatgccatggccgtttgggtcgagcagatggtg
gcgctgcattgcgccggcatcgagctggtgctggtgtcgtccggcgccgtcgccgccggt
atgagtcgcctgggctgggtgtcccgacctagcgcgatgcacgaactccaggccgccgcc
tcggtgggacagatggggttggtgcaggcctgggagtccagcttcgccctgcatggcctg
cagaccgcccaggtgttgctgacccatgacgacctttccgaccgcaagcgctacctgaac
gcccgcagcaccctgcggaccctggtcgagctgggtgtggtcccggtgatcaacgagaac
gacacggtggtcaccgacgagatccgcttcggcgacaacgacaccctggcggcactggtg
gccaacctggtcgaggccgacctgctggtgatccttaccgatcgcgacggtatgttcgac
gccgatccgcgcaacaatcccgatgcccaactgatctacgaggcgcgtgccgatgatccg
cagctcgatgcggtggccggcggcagtgccggcgccctggggcgcggcggaatgcagacc
aagctgcgggcggcgcgcctggcggcgcgttccggcgggcatacggtgatcgtcggcggg
cgtatcgagcgtgtcctcgaccgcctgcgcgccggcgaacgcctcggcaccctgttgacc
cctgatcgcagtcgcaaggcggcgcgcaagcagtggctggccggccacttgcagatgcgc
ggcaccctggtgctggacgatggggcggtgaaggcggtgagccaggatcacaagagcctg
ttgccggttggggtcaaggcggtccagggcagcttccgtcgcggcgagatggtggtctgt
gtggaccagggcgggcgcgaagtggcgcgcggcctggtcaactacagtgcgctggaggcg
cagaagatcctcggtcagccgacggatgccatcgaggccttgctcggttacgtggatggg
ccggagctggtgcatcgcgacaatctggttctggtctga

DBGET integrated database retrieval system