KEGG   Pseudomonas aeruginosa NCGM2.S1: NCGM2_1031Help
Entry
NCGM2_1031        CDS       T01974                                 

Gene name
proB
Definition
(GenBank) gamma-glutamyl kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
pnc  Pseudomonas aeruginosa NCGM2.S1
Pathway
pnc00330  Arginine and proline metabolism
pnc00332  Carbapenem biosynthesis
pnc01100  Metabolic pathways
pnc01130  Biosynthesis of antibiotics
pnc01230  Biosynthesis of amino acids
Module
pnc_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:pnc00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    NCGM2_1031 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    NCGM2_1031 (proB)
Enzymes [BR:pnc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     NCGM2_1031 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: BAK87906
Position
1:1129106..1130224
Genome map
AA seq 372 aa AA seqDB search
MRDKVTGARRWVVKIGSALLTADGRGLDRNAMAVWVEQMVALHCAGIELVLVSSGAVAAG
MSRLGWVSRPSAMHELQAAASVGQMGLVQAWESSFALHGLQTAQVLLTHDDLSDRKRYLN
ARSTLRTLVELGVVPVINENDTVVTDEIRFGDNDTLAALVANLVEADLLVILTDRDGMFD
ADPRNNPDAQLIYEARADDPQLDAVAGGSAGALGRGGMQTKLRAARLAARSGGHTVIVGG
RIERVLDRLRAGERLGTLLTPDRSRKAARKQWLAGHLQMRGTLVLDDGAVKAVSQDHKSL
LPVGVKAVQGSFRRGEMVVCVDQGGREVARGLVNYSALEAQKILGQPTDAIEALLGYVDG
PELVHRDNLVLV
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcgggacaaggtgactggcgcgcggcgctgggtggtgaagatcggtagcgccctgctg
acggccgatggccgtgggctggatcgcaatgccatggccgtttgggtcgagcagatggtg
gcgctgcattgcgccggcatcgagctggtgctggtgtcgtccggcgccgtcgccgccggt
atgagtcgcctgggctgggtgtcccgacctagcgcgatgcacgaactccaggccgccgcc
tcggtgggacagatggggttggtgcaggcctgggagtccagcttcgccctgcatggcctg
cagaccgcccaggtgttgctgacccatgacgacctttccgaccgcaagcgctacctgaac
gcccgcagcaccctgcggaccctggtcgagctgggtgtggtcccggtgatcaacgagaac
gacacggtggtcaccgacgagatccgcttcggcgacaacgacaccctggcggcactggtg
gccaacctggtcgaggccgacctgctggtgatccttaccgatcgcgacggtatgttcgac
gccgatccgcgcaacaatcccgatgcccaactgatctacgaggcgcgtgccgatgatccg
cagctcgatgcggtggccggcggcagtgccggcgccctggggcgcggcggaatgcagacc
aagctgcgggcggcgcgcctggcggcgcgttccggcgggcatacggtgatcgtcggcggg
cgtatcgagcgtgtcctcgaccgcctgcgcgccggcgaacgcctcggcaccctgttgacc
cctgatcgcagtcgcaaggcggcgcgcaagcagtggctggccggccacttgcagatgcgc
ggcaccctggtgctggacgatggggcggtgaaggcggtgagccaggatcacaagagcctg
ttgccggttggggtcaaggcggtccagggcagcttccgtcgcggcgagatggtggtctgt
gtggaccagggcgggcgcgaagtggcgcgcggcctggtcaactacagtgcgctggaggcg
cagaagatcctcggtcagccgacggatgccatcgaggccttgctcggttacgtggatggg
ccggagctggtgcatcgcgacaatctggttctggtctga

DBGET integrated database retrieval system